![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G13600.1 | ||||||||
| Common Name | AtbZIP58, bZIP58, F13B4.8, F21F23.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 196aa MW: 22873.1 Da PI: 5.605 | ||||||||
| Description | basic leucine-zipper 58 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 39.7 | 1.1e-12 | 86 | 136 | 5 | 55 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
+++rr+++NRe+ArrsR RK+ ++eL v L + N+ L ++l++ ++
AT1G13600.1 86 RKQRRMISNRESARRSRMRKQRHLDELWSQVIRLRTDNHCLMDKLNRVSES 136
79*******************************************998875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 4.1E-14 | 82 | 146 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 3.0E-11 | 84 | 136 | No hit | No description |
| PROSITE profile | PS50217 | 10.254 | 84 | 136 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.22E-12 | 86 | 135 | No hit | No description |
| Pfam | PF00170 | 1.3E-10 | 86 | 138 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 2.97E-18 | 87 | 137 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 89 | 104 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000084 | anatomy | plant sperm cell | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 196 aa Download sequence Send to blast |
MNTIPAELTG YFHYLPPDKY NNQTPIMESE YFNMPSSPTS CSSFYHLNGL INNNNYSSSS 60 NGQDLMTSNN STSDEDHQQS MVIDERKQRR MISNRESARR SRMRKQRHLD ELWSQVIRLR 120 TDNHCLMDKL NRVSESHELA LKENAKLKEE TSDLRQLISE IKSHNEDDNS FLRELEDSIS 180 NSRSDSNQSG RDFELC |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 98 | 105 | RRSRMRKQ |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 256131_at | 0.0 | ||||
| Expression Atlas | AT1G13600 | - | ||||
| AtGenExpress | AT1G13600 | - | ||||
| ATTED-II | AT1G13600 | - | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G13600.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT1G13600, AT1G75390 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G13600 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC027134 | 0.0 | AC027134.4 Arabidopsis thaliana chromosome I BAC F13B4 genomic sequence, complete sequence. | |||
| GenBank | AF332430 | 0.0 | AF332430.1 Arabidopsis thaliana clone C00105 (e) putative bZIP transcription factor (At1g13600) mRNA, complete cds. | |||
| GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| GenBank | F21F23 | 0.0 | AC027656.4 Sequence of BAC F21F23 from Arabidopsis thaliana chromosome 1, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_172817.2 | 1e-143 | basic leucine-zipper 58 | ||||
| TrEMBL | A0A178WP44 | 1e-141 | A0A178WP44_ARATH; BZIP58 | ||||
| TrEMBL | Q9LMY8 | 1e-141 | Q9LMY8_ARATH; Basic leucine-zipper 58 | ||||
| STRING | AT1G13600.1 | 1e-142 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2892 | 24 | 69 | Representative plant | OGRP3104 | 11 | 29 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G13600.1 |
| Entrez Gene | 837921 |
| iHOP | AT1G13600 |
| wikigenes | AT1G13600 |




