PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G26945.1

Common Name

BHLH163, KDR, PRE6, T2P11

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bHLH

Protein Properties

Length: 94aa MW: 10717.9 Da PI: 9.2503

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G26945.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	25.8	1.9e-08	20	60	14	54
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + ++L+ l+P++ + +s K+s + +L+++++YI++L AT1G26945.1 20 DQISDLVSKLQHLIPELRRRRSDKVSASKVLQETCNYIRNL 60 6899999*******889******************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	10.442	6	60	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	7.7E-9	20	74	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	3.01E-9	20	79	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	6.8E-6	20	60	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009416	Biological Process	response to light stimulus
GO:0040008	Biological Process	regulation of growth
GO:0005634	Cellular Component	nucleus
GO:0005737	Cellular Component	cytoplasm
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell

Sequence ? help Back to Top
Protein Sequence Length: 94 aa Download sequence Send to blast
MSSRRSSRSR QSGSSRISDD QISDLVSKLQ HLIPELRRRR SDKVSASKVL QETCNYIRNL 60 HREVDDLSDR LSELLASTDD NSAEAAIIRS LLNY

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.44742	9e-71	bud\| floral meristem\| seed

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT1G26945
AtGenExpress	AT1G26945

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a basic helix-loop-helix (bHLH) protein involved in blue/far-red light signaling. Physically interacts with HFR1 and negatively regulates its activity.
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that regulates light-mediated responses in day light conditions by binding and inhibiting the activity of the bHLH transcription factor HFR1, a critical regulator of light signaling and shade avoidance. Forms non-functional heterodimers with HFR1, causing liberation and activation of PIF4 from the transcriptionally inactive HFR1-PIF4 complex. {ECO:0000269\|PubMed:16786307, ECO:0000269\|PubMed:23224238}.

Function -- GeneRIF ? help Back to Top
KDR attenuates light mediated responses in day light condition through inhibition of the activity of basic Helix-Loop-Helix proteins involved in light signaling. [KDR] [PMID: 16786307]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G26945.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian regulation with a peak of expression at midday. {ECO:0000269\|PubMed:16786307}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G02340(R)

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q8GW32

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G26945

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK119110	1e-158	AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
GenBank	BT004686	1e-158	BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_849712.1	2e-58	basic helix-loop-helix (bHLH) DNA-binding superfamily protein
Refseq	XP_010498979.1	2e-58	PREDICTED: transcription factor PRE6
Refseq	XP_020870718.1	2e-58	transcription factor PRE6
Swissprot	Q8GW32	1e-59	PRE6_ARATH; Transcription factor PRE6
TrEMBL	A0A178WEJ4	4e-57	A0A178WEJ4_ARATH; PRE6
TrEMBL	A0A1J3CGU5	4e-57	A0A1J3CGU5_NOCCA; Transcription factor PRE6
TrEMBL	D7KPM5	4e-57	D7KPM5_ARALL; Uncharacterized protein
STRING	AT1G26945.1	6e-58	(Arabidopsis thaliana)
STRING	fgenesh2_kg.1__2658__AT1G26945.1	6e-58	(Arabidopsis lyrata)
STRING	XP_010498979.1	6e-58	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM259	28	225
Representative plant	OGRP1877	12	40

Link Out ? help Back to Top
Phytozome	AT1G26945.1
Entrez Gene	839585
iHOP	AT1G26945
wikigenes	AT1G26945

Publications ? help Back to Top
Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Lee S, et al. Overexpression of PRE1 and its homologous genes activates Gibberellin-dependent responses in Arabidopsis thaliana. Plant Cell Physiol., 2006. 47(5): p. 591-600 [PMID:16527868] Hyun Y,Lee I KIDARI, encoding a non-DNA Binding bHLH protein, represses light signal transduction in Arabidopsis thaliana. Plant Mol. Biol., 2006. 61(1-2): p. 283-96 [PMID:16786307] Cartagena JA, et al. The Arabidopsis SDG4 contributes to the regulation of pollen tube growth by methylation of histone H3 lysines 4 and 36 in mature pollen. Dev. Biol., 2008. 315(2): p. 355-68 [PMID:18252252] Zhang LY, et al. Antagonistic HLH/bHLH transcription factors mediate brassinosteroid regulation of cell elongation and plant development in rice and Arabidopsis. Plant Cell, 2009. 21(12): p. 3767-80 [PMID:20009022] Wang H, et al. Regulation of Arabidopsis brassinosteroid signaling by atypical basic helix-loop-helix proteins. Plant Cell, 2009. 21(12): p. 3781-91 [PMID:20023194] Carretero-Paulet L, et al. Genome-wide classification and evolutionary analysis of the bHLH family of transcription factors in Arabidopsis, poplar, rice, moss, and algae. Plant Physiol., 2010. 153(3): p. 1398-412 [PMID:20472752] Castelain M,Le Hir R,Bellini C The non-DNA-binding bHLH transcription factor PRE3/bHLH135/ATBS1/TMO7 is involved in the regulation of light signaling pathway in Arabidopsis. Physiol Plant, 2012. 145(3): p. 450-60 [PMID:22339648] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Hong SY, et al. A competitive peptide inhibitor KIDARI negatively regulates HFR1 by forming nonfunctional heterodimers in Arabidopsis photomorphogenesis. Mol. Cells, 2013. 35(1): p. 25-31 [PMID:23224238] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Gommers CM, et al. Molecular Profiles of Contrasting Shade Response Strategies in Wild Plants: Differential Control of Immunity and Shoot Elongation. Plant Cell, 2017. 29(2): p. 331-344 [PMID:28138015] Sanz-Fernández M, et al. Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590] Zheng K, et al. Involvement of PACLOBUTRAZOL RESISTANCE6/KIDARI, an Atypical bHLH Transcription Factor, in Auxin Responses in Arabidopsis. Front Plant Sci, 2017. 8: p. 1813 [PMID:29114256]