![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G26960.1 | ||||||||
| Common Name | AtHB23, ATHB-23, HB23, T2P11.15 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 255aa MW: 29662.9 Da PI: 4.8016 | ||||||||
| Description | homeobox protein 23 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 54.2 | 2.5e-17 | 71 | 124 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
k+++++ eql++Le+ Fe +++ +++ eLA+ lgL+ rq+ +WFqNrRa+ k
AT1G26960.1 71 KKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSK 124
456899**********************************************99 PP
| |||||||
| 2 | HD-ZIP_I/II | 121.3 | 4.8e-39 | 70 | 162 | 1 | 93 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
ekkrrl+ eq+k+LE+ Fe +kLe++rK elar+Lglqprq+a+WFqnrRAR ktkqlEkdy++Lkr++++l++ene L++++++L++++++
AT1G26960.1 70 EKKRRLNMEQLKALEKDFELGNKLESDRKLELARALGLQPRQIAIWFQNRRARSKTKQLEKDYDMLKRQFESLRDENEVLQTQNQKLQAQVMA 162
69**************************************************************************************99975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.41E-18 | 52 | 128 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 4.1E-18 | 59 | 126 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS50071 | 17.103 | 66 | 126 | IPR001356 | Homeobox domain |
| SMART | SM00389 | 2.2E-17 | 69 | 130 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 6.54E-14 | 71 | 127 | No hit | No description |
| Pfam | PF00046 | 1.1E-14 | 71 | 124 | IPR001356 | Homeobox domain |
| PRINTS | PR00031 | 4.5E-6 | 97 | 106 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 101 | 124 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 4.5E-6 | 106 | 122 | IPR000047 | Helix-turn-helix motif |
| Pfam | PF02183 | 1.4E-14 | 126 | 166 | IPR003106 | Leucine zipper, homeobox-associated |
| SMART | SM00340 | 0.0053 | 126 | 169 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0004726 | anatomy | vascular leaf primordium adaxial side | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0020148 | anatomy | shoot apical meristem | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001052 | developmental stage | vascular leaf expansion stage | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 255 aa Download sequence Send to blast |
MSCNNNGLAF FPENFSLQNH HQEEEDHPQL LQDFHGFLGK RSPMNNVQGF CNLDMNGDEE 60 YSDDGSKMGE KKRRLNMEQL KALEKDFELG NKLESDRKLE LARALGLQPR QIAIWFQNRR 120 ARSKTKQLEK DYDMLKRQFE SLRDENEVLQ TQNQKLQAQV MALKSREPIE SINLNKETEG 180 SCSDRSENIS GDIRPPEIDS QFALGHPPTT TTMQFFQNSS SEQRMVKEEN SISNMFCGID 240 DQSGFWPWLD QQQYN |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 118 | 126 | RRARSKTKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.43561 | 0.0 | flower| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 145336147 | 0.0 | ||||
| Genevisible | 263690_at | 0.0 | ||||
| Expression Atlas | AT1G26960 | - | ||||
| AtGenExpress | AT1G26960 | - | ||||
| ATTED-II | AT1G26960 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in young leaves, in the adaxial domain of leaf primordia and the rib meristem. Expressed in the styles of flowers and siliques. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:17387478}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a homeodomain leucine zipper class I (HD-Zip I) protein. | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G26960.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By gibberellic acid (GA3). {ECO:0000269|PubMed:17387478}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT1G26960, AT1G69600, AT1G75240 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G26960 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK228056 | 0.0 | AK228056.1 Arabidopsis thaliana mRNA for putative DNA-binding protein, complete cds, clone: RAFL14-55-J15. | |||
| GenBank | AY084913 | 0.0 | AY084913.1 Arabidopsis thaliana clone 121220 mRNA, complete sequence. | |||
| GenBank | BT009727 | 0.0 | BT009727.1 Arabidopsis thaliana At1g26960 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_564268.1 | 0.0 | homeobox protein 23 | ||||
| Swissprot | Q8LFD3 | 0.0 | ATB23_ARATH; Homeobox-leucine zipper protein ATHB-23 | ||||
| TrEMBL | A0A178WKR8 | 0.0 | A0A178WKR8_ARATH; HB23 | ||||
| STRING | AT1G26960.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2633 | 27 | 70 | Representative plant | OGRP129 | 16 | 189 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G26960.1 |
| Entrez Gene | 839587 |
| iHOP | AT1G26960 |
| wikigenes | AT1G26960 |




