| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SBP | 128.2 | 3.2e-40 | 175 | 251 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
+Cq++gCe dls+ k+yhr+h+vCe+hsk+p+v+vsgle+rfCqqCsrfh++sefDe+krsCr+rL++hn+rrrk+q
AT1G27370.3 175 RCQIDGCELDLSSSKDYHRKHRVCETHSKCPKVVVSGLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQ 251
6**************************************************************************97 PP
|
| Publications
? help Back to Top |
- Cardon G, et al.
Molecular characterisation of the Arabidopsis SBP-box genes. Gene, 1999. 237(1): p. 91-104 [PMID:10524240] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Rhoades MW, et al.
Prediction of plant microRNA targets. Cell, 2002. 110(4): p. 513-20 [PMID:12202040] - Schmid M, et al.
Dissection of floral induction pathways using global expression analysis. Development, 2003. 130(24): p. 6001-12 [PMID:14573523] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Vazquez F,Gasciolli V,Cr
The nuclear dsRNA binding protein HYL1 is required for microRNA accumulation and plant development, but not posttranscriptional transgene silencing. Curr. Biol., 2004. 14(4): p. 346-51 [PMID:14972688] - Vaucheret H,Vazquez F,Cr
The action of ARGONAUTE1 in the miRNA pathway and its regulation by the miRNA pathway are crucial for plant development. Genes Dev., 2004. 18(10): p. 1187-97 [PMID:15131082] - Souret FF,Kastenmayer JP,Green PJ
AtXRN4 degrades mRNA in Arabidopsis and its substrates include selected miRNA targets. Mol. Cell, 2004. 15(2): p. 173-83 [PMID:15260969] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] - Wang JW,Schwab R,Czech B,Mica E,Weigel D
Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana. Plant Cell, 2008. 20(5): p. 1231-43 [PMID:18492871] - Wu G, et al.
The sequential action of miR156 and miR172 regulates developmental timing in Arabidopsis. Cell, 2009. 138(4): p. 750-9 [PMID:19703400] - Shikata M,Koyama T,Mitsuda N,Ohme-Takagi M
Arabidopsis SBP-box genes SPL10, SPL11 and SPL2 control morphological change in association with shoot maturation in the reproductive phase. Plant Cell Physiol., 2009. 50(12): p. 2133-45 [PMID:19880401] - Nodine MD,Bartel DP
MicroRNAs prevent precocious gene expression and enable pattern formation during plant embryogenesis. Genes Dev., 2010. 24(23): p. 2678-92 [PMID:21123653] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Yu N,Niu QW,Ng KH,Chua NH
The role of miR156/SPLs modules in Arabidopsis lateral root development. Plant J., 2015. 83(4): p. 673-85 [PMID:26096676] - Xu M, et al.
Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] - Gao R,Wang Y,Gruber MY,Hannoufa A
miR156/SPL10 Modulates Lateral Root Development, Branching and Leaf Morphology in Arabidopsis by Silencing AGAMOUS-LIKE 79. Front Plant Sci, 2017. 8: p. 2226 [PMID:29354153] - Dotto M,Gómez MS,Soto MS,Casati P
UV-B radiation delays flowering time through changes in the PRC2 complex activity and miR156 levels in Arabidopsis thaliana. Plant Cell Environ., 2018. 41(6): p. 1394-1406 [PMID:29447428]
|