![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G30500.2 | ||||||||
| Common Name | F26G16.12, NFYA7, NF-YA7 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 190aa MW: 21299.7 Da PI: 9.2457 | ||||||||
| Description | nuclear factor Y, subunit A7 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 106.3 | 2.6e-33 | 99 | 155 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Ra+le+++k+ +ksrkpylheSRh hA+rRpRg+gGrF
AT1G30500.2 99 EEPVFVNAKQYHGILRRRQSRARLESQNKV-IKSRKPYLHESRHLHAIRRPRGCGGRF 155
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.8E-37 | 97 | 158 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 38.39 | 98 | 158 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 2.3E-27 | 100 | 155 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 7.2E-24 | 101 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 7.2E-24 | 132 | 155 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 190 aa Download sequence Send to blast |
MTSSIHELSD NIGSHEKQEQ RDSHFQPPIP SARNYESIVT SLVYSDPGTT NSMAPGQYPY 60 PDPYYRSIFA PPPQPYTGVH LQLMGVQQQG VPLPSDAVEE PVFVNAKQYH GILRRRQSRA 120 RLESQNKVIK SRKPYLHESR HLHAIRRPRG CGGRFLNAKK EDEHHEDSSH EEKSNLSAGK 180 SAMAASSGTS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 5e-22 | 98 | 165 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.40538 | 0.0 | flower| leaf| seed | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 261803_at | 1e-176 | ||||
| Expression Atlas | AT1G30500 | - | ||||
| AtGenExpress | AT1G30500 | - | ||||
| ATTED-II | AT1G30500 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G30500.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT1G54830, AT1G56170 | |||||
| IntAct | Search Q84JP1 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G30500 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT004274 | 0.0 | BT004274.1 Arabidopsis thaliana clone RAFL15-46-O22 (R50095) putative transcription factor (At1g30500) mRNA, complete cds. | |||
| GenBank | BT005561 | 0.0 | BT005561.1 Arabidopsis thaliana clone U50095 putative transcription factor (At1g30500) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_849733.1 | 1e-139 | nuclear factor Y, subunit A7 | ||||
| Swissprot | Q84JP1 | 1e-140 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | F4I6C2 | 1e-132 | F4I6C2_ARATH; Nuclear factor Y, subunit A7 | ||||
| STRING | AT1G30500.2 | 1e-139 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4168 | 27 | 56 | Representative plant | OGRP680 | 16 | 72 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G30500.2 |
| Entrez Gene | 839929 |
| iHOP | AT1G30500 |
| wikigenes | AT1G30500 |




