PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G31140.1

Common Name

AGL63, GOA

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 213aa MW: 24931.6 Da PI: 9.9921

Description

GORDITA

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G31140.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	75	6.1e-24	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie+k++rqvtf+kR++ ++KKA+ELSvLCd+ +iifs++++ly+++s AT1G31140.1 9 KKIEEKIKRQVTFAKRKKSLIKKAYELSVLCDVHLGLIIFSHSNRLYDFCS 59 68***********************************************96 PP
2	K-box	30.8	1.2e-11	94	155	20	81
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 + + +eienL+ ++ + G +L+ L++ eL + e +Le+sl++ R++K+e++++q +++ AT1G31140.1 94 TKESMMREIENLKLNLQLYDGHGLNLLTYDELLSFELHLESSLQHARARKSEFMHQQQQQQT 155 4567889***********************************************99876543 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-27	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	25.034	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.14E-24	1	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	5.44E-35	2	78	No hit	No description
PRINTS	PR00404	7.4E-22	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	5.6E-22	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-22	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-22	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	9.721	88	176	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.9E-6	95	156	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0030308	Biological Process	negative regulation of cell growth
GO:0048510	Biological Process	regulation of timing of transition from vegetative to reproductive phase
GO:0048530	Biological Process	fruit morphogenesis
GO:0080060	Biological Process	integument development
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000014	anatomy	rosette leaf
PO:0009001	anatomy	fruit
PO:0009009	anatomy	plant embryo
PO:0009046	anatomy	flower

Sequence ? help Back to Top
Protein Sequence Length: 213 aa Download sequence Send to blast
MRKGKRVIKK IEEKIKRQVT FAKRKKSLIK KAYELSVLCD VHLGLIIFSH SNRLYDFCSN 60 STSMENLIMR YQKEKEGQTT AEHSFHSCSD CVKTKESMMR EIENLKLNLQ LYDGHGLNLL 120 TYDELLSFEL HLESSLQHAR ARKSEFMHQQ QQQQTDQKLK GKEKGQGSSW EQLMWQAERQ 180 MMTCQRQKDP APANEGGVPF LRWGTTHRRS SPP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1n6j_A	1e-14	8	76	7	73	Myocyte-specific enhancer factor 2B
1n6j_B	1e-14	8	76	7	73	Myocyte-specific enhancer factor 2B
1tqe_P	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
1tqe_R	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
1tqe_S	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
6c9l_A	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
6c9l_B	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
6c9l_C	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
6c9l_D	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
6c9l_E	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
6c9l_F	1e-14	8	76	8	74	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT1G31140
AtGenExpress	AT1G31140

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in bud pedicels, petals, anthers, style, ovary, seeds and embryos. {ECO:0000269\|PubMed:20088901, ECO:0000269\|PubMed:20598091}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a B-sister MADS-box protein, GORDITA which is specific to the Brassicaceae. GOA is the most closely related paralog of ABS. GOA represses fruit growth and contributes to integument development. Over-expression of GOA results in disorganized floral structure and addition of carpel-like features to sepals.
UniProt	Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269\|PubMed:20088901, ECO:0000269\|PubMed:20598091, ECO:0000269\|PubMed:27233529}.

Function -- GeneRIF ? help Back to Top
GOA has a role in integument development and regulating fruit growth. [PMID: 20088901] The knockdown phenotype of GOA suggests a role for this gene in fruit longitudinal growth, while over-expression of GOA results in disorganized floral structure and addition of carpel-like features to sepals [PMID: 20598091]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00172	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G31140.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G31140

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY141243	0.0	AY141243.1 Arabidopsis thaliana MADS-box protein AGL63 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_174399.2	1e-159	GORDITA
Swissprot	Q9SA07	1e-154	AGL63_ARATH; Agamous-like MADS-box protein AGL63
TrEMBL	A0A178W639	1e-151	A0A178W639_ARATH; GOA
STRING	AT1G31140.2	1e-152	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT1G31140.1
Entrez Gene	839999
iHOP	AT1G31140
wikigenes	AT1G31140

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] De Bodt S,Raes J,Van de Peer Y,Theissen G And then there were many: MADS goes genomic. Trends Plant Sci., 2003. 8(10): p. 475-83 [PMID:14557044] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Prasad K,Zhang X,Tob The Arabidopsis B-sister MADS-box protein, GORDITA, represses fruit growth and contributes to integument development. Plant J., 2010. 62(2): p. 203-14 [PMID:20088901] Prasad K,Ambrose BA Shaping up the fruit: control of fruit size by an Arabidopsis B-sister MADS-box gene. Plant Signal Behav, 2010. 5(7): p. 899-902 [PMID:20484990] Erdmann R,Gramzow L,Melzer R,Theissen G,Becker A GORDITA (AGL63) is a young paralog of the Arabidopsis thaliana B(sister) MADS box gene ABS (TT16) that has undergone neofunctionalization. Plant J., 2010. 63(6): p. 914-24 [PMID:20598091] Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529]