![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G31320.1 | ||||||||
| Common Name | ASL6, LBD4, T19E23.11 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 172aa MW: 18697.2 Da PI: 7.773 | ||||||||
| Description | LOB domain-containing protein 4 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 144.3 | 3.7e-45 | 13 | 112 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
+CaaCk+lrr+Ca+dCv++pyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+lal++
AT1G31320.1 13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFANVHRVFGASNVNKMLQELPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQAQLALAQ 110
7**********************************************************************************************999 PP
DUF260 99 ee 100
+e
AT1G31320.1 111 AE 112
76 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 26.275 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 8.8E-45 | 13 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008150 | Biological Process | biological_process | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 172 aa Download sequence Send to blast |
MKESSRKQGA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFANVHRVFG ASNVNKMLQE 60 LPIHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQAQLALAQ AEVVHLRVRQ 120 STNFPGHGLC PDSPSSSGSP SSKQVSPQDN KGMFSHMDIV DEASLGESMW SC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 6e-50 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 6e-50 | 9 | 114 | 7 | 112 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.49931 | 0.0 | flower | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 42562436 | 0.0 | ||||
| Genevisible | 257467_at | 0.0 | ||||
| Expression Atlas | AT1G31320 | - | ||||
| AtGenExpress | AT1G31320 | - | ||||
| ATTED-II | AT1G31320 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G31320.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q9SHE9 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G31320 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB473839 | 0.0 | AB473839.1 Arabidopsis thaliana ASL6 mRNA for ASYMMETRIC LEAVES2-like 6 protein, complete cds. | |||
| GenBank | BT015067 | 0.0 | BT015067.1 Arabidopsis thaliana At1g31320 gene, complete cds. | |||
| GenBank | BT015665 | 0.0 | BT015665.1 Arabidopsis thaliana At1g31320 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_174417.1 | 1e-125 | LOB domain-containing protein 4 | ||||
| Swissprot | Q9SHE9 | 1e-126 | LBD4_ARATH; LOB domain-containing protein 4 | ||||
| TrEMBL | A0A178WLZ4 | 1e-124 | A0A178WLZ4_ARATH; LBD4 | ||||
| STRING | AT1G31320.1 | 1e-125 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 | Representative plant | OGRP60 | 16 | 318 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G31320.1 |
| Entrez Gene | 840020 |
| iHOP | AT1G31320 |
| wikigenes | AT1G31320 |




