PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G36000.1

Common Name

ASL33, LBD5, T22A15.8

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

LBD

Protein Properties

Length: 122aa MW: 14258.5 Da PI: 7.288

Description

LOB domain-containing protein 5

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G36000.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	102.1	5e-32	9	109	1	101
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 +C++C +++r+C++ C +a+yfp e +++++ +++lFG+ n++ +++++pee+++++++s+++e++a+++dP++G +g+i+kl ++++ +ka l +l+ AT1G36000.1 9 PCSVCITKNRNCPRFCEYAEYFPYELQSQYESANELFGTPNIITMMQHAPEEKKQMLATSIIMEGNAWTEDPISGGFGMIQKLMWKIMLHKAYLRELQ 106 7*********************************************************************************************9999 PP DUF260 99 eel 101 e++ AT1G36000.1 107 EKI 109 875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	22.649	8	109	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	2.7E-25	9	106	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0008150	Biological Process	biological_process

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MEPLGNRRPC SVCITKNRNC PRFCEYAEYF PYELQSQYES ANELFGTPNI ITMMQHAPEE 60 KKQMLATSII MEGNAWTEDP ISGGFGMIQK LMWKIMLHKA YLRELQEKIK EEKEKKPASS 120 LY

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	240254208	0.0
Genevisible	260187_at	0.0
Expression Atlas	AT1G36000	-
AtGenExpress	AT1G36000	-
ATTED-II	AT1G36000	-

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G36000.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G36000

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB473866	0.0	AB473866.1 Arabidopsis thaliana ASL33 mRNA for ASYMMETRIC LEAVES2-like 33 protein, complete cds.
GenBank	DQ056480	0.0	DQ056480.1 Arabidopsis thaliana LOB domain family protein (At1g36000) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_174832.1	1e-87	LOB domain-containing protein 5
Swissprot	Q9C8V8	1e-88	LBD5_ARATH; LOB domain-containing protein 5
TrEMBL	A0A178WK74	3e-85	A0A178WK74_ARATH; LBD5
STRING	AT1G36000.1	6e-87	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM12282	14	32

Link Out ? help Back to Top
Phytozome	AT1G36000.1
Entrez Gene	840503
iHOP	AT1G36000
wikigenes	AT1G36000

Publications ? help Back to Top
Iwakawa H, et al. The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper. Plant Cell Physiol., 2002. 43(5): p. 467-78 [PMID:12040093] Shuai B,Reynaga-Peña CG,Springer PS The lateral organ boundaries gene defines a novel, plant-specific gene family. Plant Physiol., 2002. 129(2): p. 747-61 [PMID:12068116] Matsumura Y,Iwakawa H,Machida Y,Machida C Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members. Plant J., 2009. 58(3): p. 525-37 [PMID:19154202]