| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | GRAS | 533.2 | 8.3e-163 | 54 | 479 | 1 | 374 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98
l++lLl+cA++v+sg+l++a+a+L++ls+laspdgd+mqR+aayfteALa+r+++s+++lykal++++t+++n+see+++++lf+e++Pilk+s+l++
AT1G50420.1 54 LIHLLLTCANHVASGSLQNANAALEQLSHLASPDGDTMQRIAAYFTEALANRILKSWPGLYKALNATQTRTNNVSEEIHVRRLFFEMFPILKVSYLLT 151
689*********************************************************************************************** PP
GRAS 99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
N+aIlea+ege++vH+iD+d+s+++QW+aLlqa++sRpegpp+lRiTgv++ +ke le++++rL + Ae+l++pf+fn+ v++rl++l++e+Lrv
AT1G50420.1 152 NRAILEAMEGEKMVHVIDLDASEPAQWLALLQAFNSRPEGPPHLRITGVHH----QKEVLEQMAHRLIEEAEKLDIPFQFNP-VVSRLDCLNVEQLRV 244
***************************************************....9**************************.7************** PP
GRAS 197 kpgEalaVnlvlqlhrll.......................................................desvsles..erdevLklvkslsPk 237
k+gEalaV++vlqlh++l ++s++l+s ++d++L+++++lsPk
AT1G50420.1 245 KTGEALAVSSVLQLHTFLasdddlmrkncalrfqnnpsgvdlqrvlmmshgsaaearendmsnnngyspsgdsASSLPLPSsgRTDSFLNAIWGLSPK 342
***********************************************************************9977777777779************** PP
GRAS 238 vvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
v+vv+eq++dhn+++++er+le+l++y+alfd+le+k+pr+s++rikvE++l+g+ei+n+++ceg+errerhe+lekW++r++ aGF++vpls++a+
AT1G50420.1 343 VMVVTEQDSDHNGSTLMERLLESLYTYAALFDCLETKVPRTSQDRIKVEKMLFGEEIKNIISCEGFERRERHEKLEKWSQRIDLAGFGNVPLSYYAML 440
************************************************************************************************** PP
GRAS 336 qaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
qa++ll+ +++dgyr++eesg++v++W+drpL+svSaWr
AT1G50420.1 441 QARRLLQGCGFDGYRIKEESGCAVICWQDRPLYSVSAWR 479
**************************************8 PP
|
| Publications
? help Back to Top |
- Pysh LD,Wysocka-Diller JW,Camilleri C,Bouchez D,Benfey PN
The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes. Plant J., 1999. 18(1): p. 111-9 [PMID:10341448] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Ogawa M, et al.
Gibberellin biosynthesis and response during Arabidopsis seed germination. Plant Cell, 2003. 15(7): p. 1591-604 [PMID:12837949] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Bolle C
The role of GRAS proteins in plant signal transduction and development. Planta, 2004. 218(5): p. 683-92 [PMID:14760535] - Goda H, et al.
Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] - Tian C,Wan P,Sun S,Li J,Chen M
Genome-wide analysis of the GRAS gene family in rice and Arabidopsis. Plant Mol. Biol., 2004. 54(4): p. 519-32 [PMID:15316287] - Gao MJ,Parkin I,Lydiate D,Hannoufa A
An auxin-responsive SCARECROW-like transcriptional activator interacts with histone deacetylase. Plant Mol. Biol., 2004. 55(3): p. 417-31 [PMID:15604690] - Curtis IS,Hanada A,Yamaguchi S,Kamiya Y
Modification of plant architecture through the expression of GA 2-oxidase under the control of an estrogen inducible promoter in Arabidopsis thaliana L. Planta, 2005. 222(6): p. 957-67 [PMID:16270204] - Levesque MP, et al.
Whole-genome analysis of the SHORT-ROOT developmental pathway in Arabidopsis. PLoS Biol., 2006. 4(5): p. e143 [PMID:16640459] - Cho YH,Yoo SD,Sheen J
Regulatory functions of nuclear hexokinase1 complex in glucose signaling. Cell, 2006. 127(3): p. 579-89 [PMID:17081979] - Zentella R, et al.
Global analysis of della direct targets in early gibberellin signaling in Arabidopsis. Plant Cell, 2007. 19(10): p. 3037-57 [PMID:17933900] - Lee MH, et al.
Large-scale analysis of the GRAS gene family in Arabidopsis thaliana. Plant Mol. Biol., 2008. 67(6): p. 659-70 [PMID:18500650] - Rieu I, et al.
Genetic analysis reveals that C19-GA 2-oxidation is a major gibberellin inactivation pathway in Arabidopsis. Plant Cell, 2008. 20(9): p. 2420-36 [PMID:18805991] - Heo JO, et al.
Funneling of gibberellin signaling by the GRAS transcription regulator scarecrow-like 3 in the Arabidopsis root. Proc. Natl. Acad. Sci. U.S.A., 2011. 108(5): p. 2166-71 [PMID:21245304] - Zhang ZL, et al.
Scarecrow-like 3 promotes gibberellin signaling by antagonizing master growth repressor DELLA in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2011. 108(5): p. 2160-5 [PMID:21245327] - Josse EM, et al.
A DELLA in disguise: SPATULA restrains the growth of the developing Arabidopsis seedling. Plant Cell, 2011. 23(4): p. 1337-51 [PMID:21478445] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Archacki R, et al.
BRAHMA ATPase of the SWI/SNF chromatin remodeling complex acts as a positive regulator of gibberellin-mediated responses in arabidopsis. PLoS ONE, 2013. 8(3): p. e58588 [PMID:23536800] - Yoshida H, et al.
DELLA protein functions as a transcriptional activator through the DNA binding of the indeterminate domain family proteins. Proc. Natl. Acad. Sci. U.S.A., 2014. 111(21): p. 7861-6 [PMID:24821766] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Yoshida H,Ueguchi-Tanaka M
DELLA and SCL3 balance gibberellin feedback regulation by utilizing INDETERMINATE DOMAIN proteins as transcriptional scaffolds. Plant Signal Behav, 2014. 9(9): p. e29726 [PMID:25763707] - Gong X, et al.
SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root. Plant Physiol., 2016. 170(3): p. 1675-83 [PMID:26818732] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] - Choi JW,Lim J
Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation. Mol. Cells, 2016. 39(7): p. 524-9 [PMID:27306644]
|