| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SBP | 134.9 | 2.6e-42 | 54 | 129 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
Cqv++C+ad++eak yhrrhkvCevh+ka++v++sgl+qrfCqqCsrfh+l+efDe+krsCrrrLa+hnerrrk++
AT1G53160.2 54 CQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAKRSCRRRLAGHNERRRKSS 129
**************************************************************************87 PP
|
| Publications
? help Back to Top |
- Cardon G, et al.
Molecular characterisation of the Arabidopsis SBP-box genes. Gene, 1999. 237(1): p. 91-104 [PMID:10524240] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Rhoades MW, et al.
Prediction of plant microRNA targets. Cell, 2002. 110(4): p. 513-20 [PMID:12202040] - Schmid M, et al.
Dissection of floral induction pathways using global expression analysis. Development, 2003. 130(24): p. 6001-12 [PMID:14573523] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Li J,Brader G,Palva ET
The WRKY70 transcription factor: a node of convergence for jasmonate-mediated and salicylate-mediated signals in plant defense. Plant Cell, 2004. 16(2): p. 319-31 [PMID:14742872] - Yamasaki K, et al.
A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors. J. Mol. Biol., 2004. 337(1): p. 49-63 [PMID:15001351] - Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] - Sunkar R,Zhu JK
Novel and stress-regulated microRNAs and other small RNAs from Arabidopsis. Plant Cell, 2004. 16(8): p. 2001-19 [PMID:15258262] - Yoo BC, et al.
A systemic small RNA signaling system in plants. Plant Cell, 2004. 16(8): p. 1979-2000 [PMID:15258266] - Birkenbihl RP,Jach G,Saedler H,Huijser P
Functional dissection of the plant-specific SBP-domain: overlap of the DNA-binding and nuclear localization domains. J. Mol. Biol., 2005. 352(3): p. 585-96 [PMID:16095614] - Wu G,Poethig RS
Temporal regulation of shoot development in Arabidopsis thaliana by miR156 and its target SPL3. Development, 2006. 133(18): p. 3539-47 [PMID:16914499] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] - Cai X, et al.
A putative CCAAT-binding transcription factor is a regulator of flowering timing in Arabidopsis. Plant Physiol., 2007. 145(1): p. 98-105 [PMID:17631525] - Wang JW,Schwab R,Czech B,Mica E,Weigel D
Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana. Plant Cell, 2008. 20(5): p. 1231-43 [PMID:18492871] - Jung JH,Seo PJ,Kang SK,Park CM
miR172 signals are incorporated into the miR156 signaling pathway at the SPL3/4/5 genes in Arabidopsis developmental transitions. Plant Mol. Biol., 2011. 76(1-2): p. 35-45 [PMID:21373962] - Lal S,Pacis LB,Smith HM
Regulation of the SQUAMOSA PROMOTER-BINDING PROTEIN-LIKE genes/microRNA156 module by the homeodomain proteins PENNYWISE and POUND-FOOLISH in Arabidopsis. Mol Plant, 2011. 4(6): p. 1123-32 [PMID:21653282] - Torti S, et al.
Analysis of the Arabidopsis shoot meristem transcriptome during floral transition identifies distinct regulatory patterns and a leucine-rich repeat protein that promotes flowering. Plant Cell, 2012. 24(2): p. 444-62 [PMID:22319055] - Kim MH,Sonoda Y,Sasaki K,Kaminaka H,Imai R
Interactome analysis reveals versatile functions of Arabidopsis COLD SHOCK DOMAIN PROTEIN 3 in RNA processing within the nucleus and cytoplasm. Cell Stress Chaperones, 2013. 18(4): p. 517-25 [PMID:23334891] - Jorgensen SA,Preston JC
Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] - Hyun Y, et al.
Site-directed mutagenesis in Arabidopsis thaliana using dividing tissue-targeted RGEN of the CRISPR/Cas system to generate heritable null alleles. Planta, 2015. 241(1): p. 271-84 [PMID:25269397] - Xu M, et al.
Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584] - Ioannidi E, et al.
Trichome patterning control involves TTG1 interaction with SPL transcription factors. Plant Mol. Biol., 2016. 92(6): p. 675-687 [PMID:27631431] - Jung JH,Lee HJ,Ryu JY,Park CM
SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering. Mol Plant, 2016. 9(12): p. 1647-1659 [PMID:27815142]
|