| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 50.1 | 6.3e-16 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+W+++Ed+ l+ ++++G +W++ ++ g+ R++k+c++rw +yl
AT1G56160.1 16 RGPWSPQEDLTLITFIQKHGHQNWRSLPKLAGLLRCGKSCRLRWINYL 63
89******************************99************97 PP
|
| 2 | Myb_DNA-binding | 46.7 | 7.2e-15 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++++ E++ ++++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
AT1G56160.1 69 RGNFSKKEEDAIIHYHQTLGNK-WSKIASFLP-GRTDNEIKNVWNTHL 114
89********************.*********.************986 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| TAIR | Encodes a member of the R2R3 transcription factor gene family that is involved in mediating induced systemic resistance. Genetic analysis of loss of function mutants and overexpressor lines indicates MYB72 is necessary but not sufficient for ISR.Interacts in vivo with EIL3. |
| UniProt | Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted (PubMed:18088336, PubMed:24278034). Involved in the up-regulation of several biosynthesis genes of secondary metabolites involved in iron uptake under conditions of iron deficiency (PubMed:25138267). Triggers tolerance to nickel (Ni) and zinc (Zn) ions (PubMed:24278034). Required in the roots during early signaling steps of rhizobacteria-mediated (e.g. P.fluorescens WCS417r) and beneficial fungi-mediated (e.g. T.asperellum T34) broad-spectrum induced systemic resistance (ISR) against several pathogens (e.g. P.syringae pv tomato, H.parasitica, P.cucumerina, A.brassicicola and B.cinerea) and implying enhanced callose deposition (PubMed:18218967, PubMed:19121118). Required for the induction of some genes (e.g. BGLU42) upon rhizobacteria-mediated ISR (PubMed:25138267). {ECO:0000269|PubMed:18088336, ECO:0000269|PubMed:18218967, ECO:0000269|PubMed:19121118, ECO:0000269|PubMed:24278034, ECO:0000269|PubMed:25138267}. |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Jiao Y, et al.
A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development. Plant Physiol., 2003. 133(4): p. 1480-93 [PMID:14605227] - Zhang S, et al.
Resources for targeted insertional and deletional mutagenesis in Arabidopsis. Plant Mol. Biol., 2003. 53(1-2): p. 133-50 [PMID:14756312] - Hampton CR, et al.
Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] - Colangelo EP,Guerinot ML
The essential basic helix-loop-helix protein FIT1 is required for the iron deficiency response. Plant Cell, 2004. 16(12): p. 3400-12 [PMID:15539473] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - van de Mortel JE, et al.
Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens. Plant Physiol., 2006. 142(3): p. 1127-47 [PMID:16998091] - Van der Ent S, et al.
MYB72 is required in early signaling steps of rhizobacteria-induced systemic resistance in Arabidopsis. Plant Physiol., 2008. 146(3): p. 1293-304 [PMID:18218967] - Yang TJ,Perry PJ,Ciani S,Pandian S,Schmidt W
Manganese deficiency alters the patterning and development of root hairs in Arabidopsis. J. Exp. Bot., 2008. 59(12): p. 3453-64 [PMID:18772308] - Segarra G,Van der Ent S,Trillas I,Pieterse CM
MYB72, a node of convergence in induced systemic resistance triggered by a fungal and a bacterial beneficial microbe. Plant Biol (Stuttg), 2009. 11(1): p. 90-6 [PMID:19121118] - Garc
Ethylene and nitric oxide involvement in the up-regulation of key genes related to iron acquisition and homeostasis in Arabidopsis. J. Exp. Bot., 2010. 61(14): p. 3885-99 [PMID:20627899] - Palmer CM,Hindt MN,Schmidt H,Clemens S,Guerinot ML
MYB10 and MYB72 are required for growth under iron-limiting conditions. PLoS Genet., 2013. 9(11): p. e1003953 [PMID:24278034] - Zamioudis C,Hanson J,Pieterse CM
β-Glucosidase BGLU42 is a MYB72-dependent key regulator of rhizobacteria-induced systemic resistance and modulates iron deficiency responses in Arabidopsis roots. New Phytol., 2014. 204(2): p. 368-79 [PMID:25138267] - Zamioudis C, et al.
Rhizobacterial volatiles and photosynthesis-related signals coordinate MYB72 expression in Arabidopsis roots during onset of induced systemic resistance and iron-deficiency responses. Plant J., 2015. 84(2): p. 309-22 [PMID:26307542] - Zhou C, et al.
Paenibacillus polymyxa BFKC01 enhances plant iron absorption via improved root systems and activated iron acquisition mechanisms. Plant Physiol. Biochem., 2016. 105: p. 162-173 [PMID:27105423] - Wang C,Yao X,Yu D,Liang G
Fe-deficiency-induced expression of bHLH104 enhances Fe-deficiency tolerance of Arabidopsis thaliana. Planta, 2017. 246(3): p. 421-431 [PMID:28451750] - Martínez-Medina A,Van Wees SCM,Pieterse CMJ
Airborne signals from Trichoderma fungi stimulate iron uptake responses in roots resulting in priming of jasmonic acid-dependent defences in shoots of Arabidopsis thaliana and Solanum lycopersicum. Plant Cell Environ., 2017. 40(11): p. 2691-2705 [PMID:28667819] - Stringlis IA, et al.
MYB72-dependent coumarin exudation shapes root microbiome assembly to promote plant health. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(22): p. E5213-E5222 [PMID:29686086] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|