PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G59530.1

Common Name

ATBZIP4, bZIP4

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 148aa MW: 17234.6 Da PI: 8.0399

Description

basic leucine-zipper 4

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G59530.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	39	1.7e-12	48	96	3	51
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 ++k+ rr ++NRe+A+rsR +Kk++ eeL+e+v L N++Lk++l + AT1G59530.1 48 DDKKRRRTISNRESAKRSRMKKKKRFEELTEEVNRLNIRNQELKNRLAN 96 589*****************************************77754 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	6.3E-12	46	117	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.691	48	97	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.9E-12	48	96	No hit	No description
Pfam	PF00170	6.2E-10	49	96	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	1.62E-9	50	97	No hit	No description
PROSITE pattern	PS00036	0	53	68	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 148 aa Download sequence Send to blast
MFYTNMETVH NCFNDATITG DEIIDILAFL QSDESDNPSG INEVVPVDDK KRRRTISNRE 60 SAKRSRMKKK KRFEELTEEV NRLNIRNQEL KNRLANVVSC GNFISRENNR LKTESVCLEI 120 RLLELYRFLV AMQSPISTSV NYITTLEI

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	51	71	RRRTISNRESAKRSRMKKKKR

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	257471_at	0.0
Expression Atlas	AT1G59530	-
AtGenExpress	AT1G59530	-
ATTED-II	AT1G59530	-

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269\|PubMed:26973252}.

Function -- GeneRIF ? help Back to Top
ZmbZIP4 is a positive regulator of plant abiotic stress responses and is involved in root development in maize. [PMID: 30126870]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G59530.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G59530

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC009317	0.0	AC009317.4 Genomic sequence for Arabidopsis thaliana BAC T30E16 from chromosome I, complete sequence.
GenBank	AC027036	0.0	AC027036.12 Arabidopsis thaliana chromosome 1 BAC T4M14 genomic sequence, complete sequence.
GenBank	AF400619	0.0	AF400619.1 Arabidopsis thaliana transcription factor-like protein bZIP4 mRNA, complete cds.
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176162.1	1e-104	basic leucine-zipper 4
Swissprot	Q9LQ65	1e-105	BZIP4_ARATH; Basic leucine zipper 4
TrEMBL	A0A178WN29	1e-101	A0A178WN29_ARATH; BZIP4
STRING	AT1G59530.1	1e-103	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM12232	24	32
Representative plant	OGRP11732	4	6

Link Out ? help Back to Top
Phytozome	AT1G59530.1
Entrez Gene	842243
iHOP	AT1G59530
wikigenes	AT1G59530

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Cheng C, et al. An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice. BMC Genomics, 2007. 8: p. 175 [PMID:17577400] Guo YL, et al. Genome-wide comparison of nucleotide-binding site-leucine-rich repeat-encoding genes in Arabidopsis. Plant Physiol., 2011. 157(2): p. 757-69 [PMID:21810963] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Nowak K,Gaj MD Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis. J. Plant Physiol., 2016. 193: p. 119-26 [PMID:26973252] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470] Ma H, et al. ZmbZIP4 Contributes to Stress Resistance in Maize by Regulating ABA Synthesis and Root Development. Plant Physiol., 2018. 178(2): p. 753-770 [PMID:30126870]