![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G65360.1 | ||||||||
| Common Name | AGL23, T8F5.14 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 226aa MW: 25336.9 Da PI: 9.6685 | ||||||||
| Description | AGAMOUS-like 23 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 68.5 | 6.4e-22 | 19 | 62 | 6 | 49 |
HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
+sn qvtfskR++g++KKA+E ++LCda++a+i+fs+ gk++ +
AT1G65360.1 19 ESNLQVTFSKRKAGLFKKASEFCTLCDAKIAMIVFSPAGKVFSF 62
7899*************************************988 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.3E-31 | 6 | 65 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 24.095 | 6 | 66 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.22E-25 | 7 | 89 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-18 | 8 | 28 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.1E-23 | 16 | 62 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-18 | 28 | 43 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.3E-18 | 43 | 64 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009553 | Biological Process | embryo sac development | ||||
| GO:0009658 | Biological Process | chloroplast organization | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009089 | anatomy | endosperm | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020090 | anatomy | embryo sac central cell | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0025074 | anatomy | embryo sac | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 226 aa Download sequence Send to blast |
MVKKTLGRRK VEIVKMTKES NLQVTFSKRK AGLFKKASEF CTLCDAKIAM IVFSPAGKVF 60 SFGHPNVDVL LDHFRGCVVG HNNTNLDESY TKLHVQMLNK SYTEVKAEVE KEQKNKQSRA 120 QNERENENAE EWWSKSPLEL NLSQSTCMIR VLKDLKKIVD EKAIQLIHQT NPNFYVGSSS 180 NAAAPATVSG GNISTNQGFF DQNGMTTNPT QTLLFGFDIM NRTPGV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 1e-15 | 6 | 87 | 1 | 83 | MEF2 CHIMERA |
| 6byy_B | 1e-15 | 6 | 87 | 1 | 83 | MEF2 CHIMERA |
| 6byy_C | 1e-15 | 6 | 87 | 1 | 83 | MEF2 CHIMERA |
| 6byy_D | 1e-15 | 6 | 87 | 1 | 83 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 18408263 | 0.0 | ||||
| Genevisible | 264182_at | 0.0 | ||||
| Expression Atlas | AT1G65360 | - | ||||
| AtGenExpress | AT1G65360 | - | ||||
| ATTED-II | AT1G65360 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in the functional megaspore until maturity of the embryo sac. After fertilization, expressed in the embryo and endosperm until the early torpedo stage. Not expressed in mature embryo. {ECO:0000269|PubMed:18346189}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes AGL23, a Type I MADS-box gene that controls female gametophyte development and the biogenesis of organelles during embryo development. | |||||
| UniProt | Probable transcription factor that controls female gametophyte (megagametogenesis) development and chloroplast biogenesis during embryo development. {ECO:0000269|PubMed:18346189}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G65360.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search O80807 | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: Embryonic lethality when homozygous. {ECO:0000269|PubMed:18346189}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G65360 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY141230 | 0.0 | AY141230.1 Arabidopsis thaliana MADS-box protein AGL23 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_176715.1 | 1e-170 | AGAMOUS-like 23 | ||||
| Swissprot | O80807 | 1e-171 | AGL23_ARATH; Agamous-like MADS-box protein AGL23 | ||||
| TrEMBL | A0A178WCT9 | 1e-149 | A0A178WCT9_ARATH; AGL23 | ||||
| STRING | AT1G65360.1 | 1e-169 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM17507 | 7 | 10 | Representative plant | OGRP16 | 17 | 761 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G65360.1 |
| Entrez Gene | 842846 |
| iHOP | AT1G65360 |
| wikigenes | AT1G65360 |




