![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G66380.1 | ||||||||
| Common Name | AtMYB114, MYB114, T27F4.13 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 139aa MW: 16006.7 Da PI: 10.9187 | ||||||||
| Description | myb domain protein 114 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 52.6 | 1.1e-16 | 10 | 57 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd ll +++ ++G g W+ ++ + g++R++k+c++rw++yl
AT1G66380.1 10 KGAWTAEEDSLLRQCIGKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 57
79*********************************************7 PP
| |||||||
| 2 | Myb_DNA-binding | 53.5 | 5.5e-17 | 63 | 108 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg+++ +E +ll++++k+lG++ W++Ia +++ gRt++++k++w+++l
AT1G66380.1 63 RGKFSSDEVDLLLRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNTHL 108
89********************.*********.************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 25.73 | 5 | 61 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-22 | 5 | 60 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.68E-29 | 7 | 104 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.5E-14 | 9 | 59 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.2E-15 | 10 | 57 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.01E-10 | 12 | 57 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 3.6E-24 | 61 | 111 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 7.5E-16 | 62 | 110 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 20.909 | 62 | 112 | IPR017930 | Myb domain |
| Pfam | PF00249 | 1.4E-15 | 63 | 108 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0031540 | Biological Process | regulation of anthocyanin biosynthetic process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MEGSSKGLRK GAWTAEEDSL LRQCIGKYGE GKWHQVPLRA GLNRCRKSCR LRWLNYLKPS 60 IKRGKFSSDE VDLLLRLHKL LGNRWSLIAG RLPGRTANDV KNYWNTHLSK KHEPCCKTKI 120 KRINIITPPN TPAQKVDIF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 3e-23 | 8 | 111 | 5 | 107 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 260139_at | 0.0 | ||||
| Expression Atlas | AT1G66380 | - | ||||
| AtGenExpress | AT1G66380 | - | ||||
| ATTED-II | AT1G66380 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a member of the MYB family of transcription factors. Involved in regulation of anthocyanin biosynthesis. Affects the expression of enzymes involved in later steps of anthocyanin biosynthesis | |||||
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G66380.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | jasmonic acid | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q9FNV8 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G66380 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY008379 | 0.0 | AY008379.1 Arabidopsis thaliana putative transcription factor MYB114 mRNA, complete cds. | |||
| GenBank | AY519567 | 0.0 | AY519567.1 Arabidopsis thaliana MYB transcription factor (At1g66380) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_176812.1 | 5e-99 | myb domain protein 114 | ||||
| Swissprot | Q9FNV8 | 1e-100 | MY114_ARATH; Transcription factor MYB114 | ||||
| TrEMBL | D7KTP5 | 1e-83 | D7KTP5_ARALL; MYB transcription factor | ||||
| STRING | AT1G66380.1 | 2e-98 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G66380.1 |
| Entrez Gene | 842956 |
| iHOP | AT1G66380 |
| wikigenes | AT1G66380 |




