PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G68880.1

Common Name

AtbZIP, bZIP, BZIP8, F14K14.1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 138aa MW: 16245.4 Da PI: 10.209

Description

basic leucine-zipper 8

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G68880.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	40.2	7.6e-13	47	100	5	58
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 ++ rrk +NRe+ArrsR RK+ +eeL +L ++Nk+L +el++ ++ ++k AT1G68880.1 47 RKRRRKVSNRESARRSRMRKQRHMEELWSMLVQLINKNKSLVDELSQARECYEK 100 6789******************************************99998886 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	1.4E-9	38	100	No hit	No description
SMART	SM00338	1.2E-12	43	107	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.473	45	108	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.5E-10	46	100	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	8.13E-11	47	98	No hit	No description
CDD	cd14702	2.38E-14	48	98	No hit	No description
PROSITE pattern	PS00036	0	50	65	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009005	anatomy	root
PO:0009025	anatomy	vascular leaf
PO:0007115	developmental stage	LP.04 four leaves visible stage

Sequence ? help Back to Top
Protein Sequence Length: 138 aa Download sequence Send to blast
MAGSVYNLPS QNPNPQSLFQ IFVDRVPLSN LPATSDDSSR TAEDNERKRR RKVSNRESAR 60 RSRMRKQRHM EELWSMLVQL INKNKSLVDE LSQARECYEK VIEENMKLRE ENSKSRKMIG 120 EIGLNRFLSV EADQIWTF

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	46	50	RKRRR
2	59	66	RRSRMRKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.26571	0.0	root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	260030_at	0.0
Expression Atlas	AT1G68880	-
AtGenExpress	AT1G68880	-
ATTED-II	AT1G68880	-

Function -- GeneRIF ? help Back to Top
A more precise definition of the subcellular localization of HBZ, its interaction with cellular factors and an estimate of its amount in vivo both in HTLV-1 infected and in ATL tumor cells was studied. [PMID: 26140924]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G68880.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G68880

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC011665	0.0	AC011665.8 Arabidopsis thaliana chromosome 1 BAC T6L1 genomic sequence, complete sequence.
GenBank	AC011914	0.0	AC011914.9 Arabidopsis thaliana chromosome 1 BAC F14K14 genomic sequence, complete sequence.
GenBank	AF400621	0.0	AF400621.1 Arabidopsis thaliana transcription factor-like protein bZIP8 mRNA, complete cds.
GenBank	BT024817	0.0	BT024817.1 Arabidopsis thaliana At1g68880 gene, complete cds.
GenBank	CP002684	0.0	CP002684.1 Arabidopsis thaliana chromosome 1 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_177054.1	2e-97	basic leucine-zipper 8
Swissprot	Q9CA46	2e-98	BZIP8_ARATH; Basic leucine zipper 8
TrEMBL	A0A178WI50	3e-95	A0A178WI50_ARATH; BZIP
STRING	AT1G68880.1	9e-97	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM15035	16	19
Representative plant	OGRP3104	11	29

Link Out ? help Back to Top
Phytozome	AT1G68880.1
Entrez Gene	843221
iHOP	AT1G68880
wikigenes	AT1G68880

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Dal Bosco C, et al. Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] William DA, et al. Genomic identification of direct target genes of LEAFY. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(6): p. 1775-80 [PMID:14736918] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Scheible WR, et al. Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Lee DJ, et al. Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response. Mol. Genet. Genomics, 2007. 277(2): p. 115-37 [PMID:17061125] Reeves WM,Lynch TJ,Mobin R,Finkelstein RR Direct targets of the transcription factors ABA-Insensitive(ABI)4 and ABI5 reveal synergistic action by ABI4 and several bZIP ABA response factors. Plant Mol. Biol., 2011. 75(4-5): p. 347-63 [PMID:21243515] Agarwal P,Kapoor S,Tyagi AK Transcription factors regulating the progression of monocot and dicot seed development. Bioessays, 2011. 33(3): p. 189-202 [PMID:21319185] Liu JZ, et al. Soybean homologs of MPK4 negatively regulate defense responses and positively regulate growth and development. Plant Physiol., 2011. 157(3): p. 1363-78 [PMID:21878550] Zander M,Chen S,Imkampe J,Thurow C,Gatz C Repression of the Arabidopsis thaliana jasmonic acid/ethylene-induced defense pathway by TGA-interacting glutaredoxins depends on their C-terminal ALWL motif. Mol Plant, 2012. 5(4): p. 831-40 [PMID:22207719] MEDIATOR25 acts as an integrative hub for the regulation of jasmonate-responsive gene expression in Arabidopsis. Plant Physiol., 2012. 160(1): p. 541-55 [PMID:22822211] Chen D, et al. Antagonistic basic helix-loop-helix/bZIP transcription factors form transcriptional modules that integrate light and reactive oxygen species signaling in Arabidopsis. Plant Cell, 2013. 25(5): p. 1657-73 [PMID:23645630] Raval GU, et al. Localization, quantification and interaction with host factors of endogenous HTLV-1 HBZ protein in infected cells and ATL. Retrovirology, 2015. 12: p. 59 [PMID:26140924] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]