![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G71692.1 | ||||||||
| Common Name | AGL12, F14O23.5, F26A9.6, XAL1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 211aa MW: 23918.7 Da PI: 7.3431 | ||||||||
| Description | AGAMOUS-like 12 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 82.2 | 3.4e-26 | 9 | 57 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
krien rqvtf+kRr+g+lKKA+ELSvLCdae+ v+ifs++gkl+e
AT1G71692.1 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEIGVVIFSPQGKLFEL 57
79********************************************996 PP
| |||||||
| 2 | K-box | 58.1 | 3.8e-20 | 99 | 181 | 18 | 100 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
+ e++ Lk+eie+Lq+ + + G + + ++l+eL Le++Le +++iRs K++++l++i+ l++ke l+++nk+L +k+ee
AT1G71692.1 99 KDEINVLKQEIEMLQKGISYMFGGGDGAMNLEELLLLEKHLEYWISQIRSAKMDVMLQEIQSLRNKEGVLKNTNKYLLEKIEE 181
6799****************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.885 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 8.76E-29 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 8.0E-37 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.50E-40 | 2 | 78 | No hit | No description |
| PRINTS | PR00404 | 1.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.7E-24 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 12.564 | 95 | 185 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 2.3E-19 | 99 | 179 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0040008 | Biological Process | regulation of growth | ||||
| GO:0048364 | Biological Process | root development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000005 | anatomy | cultured plant cell | ||||
| PO:0000229 | anatomy | flower meristem | ||||
| PO:0000263 | anatomy | non-hair root epidermal cell | ||||
| PO:0003011 | anatomy | root vascular system | ||||
| PO:0003015 | anatomy | primary root differentiation zone | ||||
| PO:0005017 | anatomy | flower vascular system | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020124 | anatomy | root stele | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 211 aa Download sequence Send to blast |
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEIGVVIFSP QGKLFELATK 60 GTMEGMIDKY MKCTGGGRGS SSATFTAQEQ LQPPNLDPKD EINVLKQEIE MLQKGISYMF 120 GGGDGAMNLE ELLLLEKHLE YWISQIRSAK MDVMLQEIQS LRNKEGVLKN TNKYLLEKIE 180 ENNNSILDAN FAVMETNYSY PLTMPSEIFQ F |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
| 5f28_B | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
| 5f28_C | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
| 5f28_D | 3e-16 | 1 | 70 | 1 | 69 | MEF2C |
| 6byy_A | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_B | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_C | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 4e-16 | 1 | 70 | 1 | 69 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.19719 | 0.0 | root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 261504_at | 0.0 | ||||
| Expression Atlas | AT1G71692 | - | ||||
| AtGenExpress | AT1G71692 | - | ||||
| ATTED-II | AT1G71692 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269|PubMed:11855641}. | |||||
| Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269|PubMed:11855641, ECO:0000269|PubMed:18203871, ECO:0000269|PubMed:7549482}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a member of the MADS box family of transcription factors. Involved in root cell differentiation and flowering time. Loss of function mutations have abnormal cellular differentiation in the roots and are late flowering. AGL12 along with AGL14, and AGL17 is preferentially expressed in root tissues and represent the only characterized MADS box genes expressed in roots. | |||||
| UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G71692.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Target Gene (A: Activate/R: Repress) | |||||
| ATRM | AT1G65480(A), AT2G45660(A), AT5G61850(A) | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q38841 | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: Retarded root growth, and altered root meristem size and stem-cell patterning. Late flowering phenotype. {ECO:0000269|PubMed:18203871}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G71692 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK228190 | 0.0 | AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22. | |||
| GenBank | BT006157 | 0.0 | BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds. | |||
| GenBank | BT008332 | 0.0 | BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds. | |||
| GenBank | BT008524 | 0.0 | BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_565022.1 | 1e-156 | AGAMOUS-like 12 | ||||
| Swissprot | Q38841 | 1e-157 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
| TrEMBL | A0A178W249 | 1e-154 | A0A178W249_ARATH; XAL1 | ||||
| STRING | AT1G71692.1 | 1e-155 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7052 | 26 | 41 | Representative plant | OGRP16 | 17 | 761 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G71692.1 |
| Entrez Gene | 843497 |
| iHOP | AT1G71692 |
| wikigenes | AT1G71692 |




