| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 61.8 | 1e-19 | 33 | 88 | 1 | 56 |
TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
+++ +++t++q+++Le+ F+++++p++++r +L+++lgL rq+k+WFqNrR++ k
AT1G73360.1 33 KKRYHRHTAQQIQRLESSFKECPHPDEKQRNQLSRELGLAPRQIKFWFQNRRTQLK 88
688999**********************************************9877 PP
|
| 2 | START | 157.2 | 1.3e-49 | 237 | 457 | 2 | 206 |
HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEEC CS
START 2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevis 86
+a++a++el+++ + +ep+W++ +++n + f++s + +++ea+r sg+v+m+++ lv ++d +W+e ++ + +tl+vis
AT1G73360.1 237 IALTAMEELLRLLQTNEPLWTRTDgcrDILNLGSYENVFPRSSNrgknqnFRVEASRSSGIVFMNAMALVDMFMDCV-KWTELFPsiiaASKTLAVIS 333
6899*******************999999999999999998888999999***************************.*******9**99******** PP
TT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS.X CS
START 87 sg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgr.l 176
sg gal+l + e+ +lsplv+ R+f +Ry++q ++g+w++v vS d +q+++ +s++ R +pSg+li++++ng+skvtwveh++ +++ l
AT1G73360.1 334 SGmggtheGALHLLYEEMEVLSPLVAtREFCELRYCQQTEQGSWIVVNVSYDLPQFVS-HSQSYR---FPSGCLIQDMPNGYSKVTWVEHIETEEKeL 427
**********************************************************.999999...*************************87538 PP
XHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
START 177 phwllrslvksglaegaktwvatlqrqcek 206
+h+l+r ++++g+a+ga +wv tlqr ce+
AT1G73360.1 428 VHELYREIIHRGIAFGADRWVTTLQRMCER 457
8***************************97 PP
|
| Publications
? help Back to Top |
- Tavares R,Aubourg S,Lecharny A,Kreis M
Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2. Plant Mol. Biol., 2000. 42(5): p. 703-17 [PMID:10809443] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Schrick K,Nguyen D,Karlowski WM,Mayer KF
START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors. Genome Biol., 2004. 5(6): p. R41 [PMID:15186492] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Nakamura M, et al.
Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis. Plant Physiol., 2006. 141(4): p. 1363-75 [PMID:16778018] - Gao L,Xiang CB
The genetic locus At1g73660 encodes a putative MAPKKK and negatively regulates salt tolerance in Arabidopsis. Plant Mol. Biol., 2008. 67(1-2): p. 125-34 [PMID:18299802] - Yu H, et al.
Activated expression of an Arabidopsis HD-START protein confers drought tolerance with improved root system and reduced stomatal density. Plant Cell, 2008. 20(4): p. 1134-51 [PMID:18451323] - Cao YJ, et al.
Ectopic overexpression of AtHDG11 in tall fescue resulted in enhanced tolerance to drought and salt stress. Plant Cell Rep., 2009. 28(4): p. 579-88 [PMID:19132376] - Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development. Mol Plant, 2009. 2(4): p. 803-22 [PMID:19626137] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Meinke DW
A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] - Roeder AH,Cunha A,Ohno CK,Meyerowitz EM
Cell cycle regulates cell type in the Arabidopsis sepal. Development, 2012. 139(23): p. 4416-27 [PMID:23095885] - Yu L, et al.
Arabidopsis enhanced drought tolerance1/HOMEODOMAIN GLABROUS11 confers drought tolerance in transgenic rice without yield penalty. Plant Physiol., 2013. 162(3): p. 1378-91 [PMID:23735506] - Xu P, et al.
HDG11 upregulates cell-wall-loosening protein genes to promote root elongation in Arabidopsis. J. Exp. Bot., 2014. 65(15): p. 4285-95 [PMID:24821957] - Khosla A, et al.
HD-Zip Proteins GL2 and HDG11 Have Redundant Functions in Arabidopsis Trichomes, and GL2 Activates a Positive Feedback Loop via MYB23. Plant Cell, 2014. 26(5): p. 2184-2200 [PMID:24824485] - Horstman A, et al.
AIL and HDG proteins act antagonistically to control cell proliferation. Development, 2015. 142(3): p. 454-64 [PMID:25564655] - Cai XT,Xu P,Wang Y,Xiang CB
Activated expression of AtEDT1/HDG11 promotes lateral root formation in Arabidopsis mutant edt1 by upregulating jasmonate biosynthesis. J Integr Plant Biol, 2015. 57(12): p. 1017-30 [PMID:25752924] - Yu LH, et al.
Arabidopsis EDT1/HDG11 improves drought and salt tolerance in cotton and poplar and increases cotton yield in the field. Plant Biotechnol. J., 2016. 14(1): p. 72-84 [PMID:25879154] - Zhu Z, et al.
Overexpression of AtEDT1/HDG11 in Chinese Kale (Brassica oleracea var. alboglabra) Enhances Drought and Osmotic Stress Tolerance. Front Plant Sci, 2016. 7: p. 1285 [PMID:27625663] - Liu Y, et al.
Overexpression of AtEDT1 promotes root elongation and affects medicinal secondary metabolite biosynthesis in roots of transgenic Salvia miltiorrhiza. Protoplasma, 2017. 254(4): p. 1617-1625 [PMID:27915455] - Ueda M, et al.
Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote. Genes Dev., 2017. 31(6): p. 617-627 [PMID:28404632] - Lung SC, et al.
Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors. New Phytol., 2018. 218(1): p. 183-200 [PMID:29288621] - Zheng G, et al.
Over-Expression of Arabidopsis EDT1 Gene Confers Drought Tolerance in Alfalfa (Medicago sativa L.). Front Plant Sci, 2017. 8: p. 2125 [PMID:29326737]
|