![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G74660.1 | ||||||||
| Common Name | F1M20.34, MIF1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 102aa MW: 11212.5 Da PI: 8.3798 | ||||||||
| Description | mini zinc finger 1 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 107.5 | 7.9e-34 | 36 | 92 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa++Gg+avDGC+Efm++ g egt++al+CaACgCHRnFHR+ev++e
AT1G74660.1 36 NVRYVECQKNHAANIGGYAVDGCREFMAA-GVEGTVDALRCAACGCHRNFHRKEVDTE 92
79**************************9.999*********************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 6.0E-39 | 2 | 101 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 7.0E-30 | 36 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 7.5E-28 | 38 | 89 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 25.362 | 39 | 88 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009640 | Biological Process | photomorphogenesis | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009741 | Biological Process | response to brassinosteroid | ||||
| GO:0043392 | Biological Process | negative regulation of DNA binding | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048509 | Biological Process | regulation of meristem development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0007131 | developmental stage | seedling development stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MMKKRQMVIK QRSRNSNTSS SWTTTSSSSS SSEISNVRYV ECQKNHAANI GGYAVDGCRE 60 FMAAGVEGTV DALRCAACGC HRNFHRKEVD TEVVCEYSPP NA |
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 260226_at | 1e-147 | ||||
| Expression Atlas | AT1G74660 | - | ||||
| AtGenExpress | AT1G74660 | - | ||||
| ATTED-II | AT1G74660 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in roots and stems, present in siliques and seedlings, and weakly observed in petioles, leaves and flowers. {ECO:0000269|PubMed:16412086}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Constitutive overexpression of MIF1 caused dramatic developmental defects, seedlings were non-responsive to gibberellin (GA) for cell elongation, hypersensitive to the GA synthesis inhibitor paclobutrazol (PAC) and abscisic acid (ABA), and hyposensitive to auxin, brassinosteroid and cytokinin, but normally responsive to ethylene. | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G74660.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | abscisic acid, auxin, brassinosteroid, cytokinin, gibberellin | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q9CA51 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G74660 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC011765 | 1e-172 | AC011765.6 Arabidopsis thaliana chromosome 1 BAC F1M20 genomic sequence, complete sequence. | |||
| GenBank | AY085327 | 1e-172 | AY085327.1 Arabidopsis thaliana clone 14583 mRNA, complete sequence. | |||
| GenBank | BT024806 | 1e-172 | BT024806.1 Arabidopsis thaliana At1g74660 gene, complete cds. | |||
| GenBank | CP002684 | 1e-172 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_565088.1 | 2e-71 | mini zinc finger 1 | ||||
| Swissprot | Q9CA51 | 1e-72 | MIF1_ARATH; Mini zinc finger protein 1 | ||||
| TrEMBL | A0A178WD69 | 4e-70 | A0A178WD69_ARATH; MIF1 | ||||
| STRING | AT1G74660.1 | 6e-71 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM944 | 28 | 114 | Representative plant | OGRP91 | 16 | 237 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G74660.1 |
| Entrez Gene | 843805 |
| iHOP | AT1G74660 |
| wikigenes | AT1G74660 |




