![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT1G74840.1 | ||||||||
| Common Name | F25A4.19, F9E10.31 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 265aa MW: 29265.8 Da PI: 6.6834 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 45.1 | 2.4e-14 | 97 | 141 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE++l++ + ++ G+g+Wk I+r + k+Rt q+ s+ qky
AT1G74840.1 97 PWTEEEHKLFLLGLQRVGKGDWKGISRNFVKTRTSTQVASHAQKY 141
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.102 | 90 | 146 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 3.45E-17 | 92 | 147 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 3.7E-17 | 93 | 144 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 1.2E-9 | 94 | 144 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-10 | 96 | 141 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 6.60E-9 | 97 | 142 | No hit | No description |
| Pfam | PF00249 | 3.2E-11 | 97 | 141 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006338 | Biological Process | chromatin remodeling | ||||
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
| GO:0009651 | Biological Process | response to salt stress | ||||
| GO:0009723 | Biological Process | response to ethylene | ||||
| GO:0009733 | Biological Process | response to auxin | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009739 | Biological Process | response to gibberellin | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0035066 | Biological Process | positive regulation of histone acetylation | ||||
| GO:0046686 | Biological Process | response to cadmium ion | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0003713 | Molecular Function | transcription coactivator activity | ||||
| GO:0004402 | Molecular Function | histone acetyltransferase activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 265 aa Download sequence Send to blast |
MADGSTSSSE STTACAGSGT RREIMLFGVR VVLDPMRKCV SLNNLSDYEQ TAETPKIDGE 60 DRDEQDMNKT PAGYASADEA LPMSSSNGKI ERKRGVPWTE EEHKLFLLGL QRVGKGDWKG 120 ISRNFVKTRT STQVASHAQK YFLRRSNLNR RRRRSSLFDM TTDTVIPMEE DHQVLIQENT 180 SQSSSPVPEI NNFSIHPVMQ VFPEFPVPTG NQSYGQLTSS NLINLVPLTF QSSPAPLSLN 240 LSLASSNLNE PSPSMHPAFN TIGVA |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.11594 | 0.0 | flower| root| silique | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 262166_at | 0.0 | ||||
| Expression Atlas | AT1G74840 | - | ||||
| AtGenExpress | AT1G74840 | - | ||||
| ATTED-II | AT1G74840 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00236 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT1G74840.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT1G74840 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY070098 | 0.0 | AY070098.1 Arabidopsis thaliana putative myb-related transcription activator protein (At1g74840) mRNA, complete cds. | |||
| GenBank | AY096393 | 0.0 | AY096393.1 Arabidopsis thaliana putative myb-related transcription activator (At1g74840) mRNA, complete cds. | |||
| GenBank | AY519510 | 0.0 | AY519510.1 Arabidopsis thaliana MYB transcription factor (At1g74840) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_177622.1 | 0.0 | Homeodomain-like superfamily protein | ||||
| Swissprot | Q2V9B0 | 6e-55 | MY1R1_SOLTU; Transcription factor MYB1R1 | ||||
| TrEMBL | Q9S7N6 | 0.0 | Q9S7N6_ARATH; F25A4.19 protein | ||||
| STRING | AT1G74840.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2461 | 26 | 69 | Representative plant | OGRP394 | 16 | 99 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT1G74840.1 |
| Entrez Gene | 843823 |
| iHOP | AT1G74840 |
| wikigenes | AT1G74840 |




