| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Whirly | 220.3 | 1.7e-68 | 90 | 228 | 1 | 139 |
Whirly 1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkveP 98
s+yk+kaal++++++p+f+al+sg++kl+++G+lll++a+a+++r+ydW++kq+f+ls+te+++lv+l+++esceffhdp++++++eGkvrk+lkveP
AT2G02740.2 90 SIYKGKAALTIEPRAPEFVALESGAFKLTKEGFLLLQFAPAAGVRQYDWSRKQVFSLSVTEIGNLVSLGPRESCEFFHDPFKGKGDEGKVRKVLKVEP 187
7************************************************************************************************* PP
Whirly 99 lpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
lpdGsG f+nlsv+n+l++++es+++P++kaefavl+s+++
AT2G02740.2 188 LPDGSGRFFNLSVQNKLLNVDESVYIPITKAEFAVLISAFN 228
**************************************996 PP
|
| Publications
? help Back to Top |
- Vermel M, et al.
A family of RRM-type RNA-binding proteins specific to plant mitochondria. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(9): p. 5866-71 [PMID:11972043] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] - Desveaux D, et al.
A "Whirly" transcription factor is required for salicylic acid-dependent disease resistance in Arabidopsis. Dev. Cell, 2004. 6(2): p. 229-40 [PMID:14960277] - Desveaux D,Maréchal A,Brisson N
Whirly transcription factors: defense gene regulation and beyond. Trends Plant Sci., 2005. 10(2): p. 95-102 [PMID:15708347] - Krause K, et al.
DNA-binding proteins of the Whirly family in Arabidopsis thaliana are targeted to the organelles. FEBS Lett., 2005. 579(17): p. 3707-12 [PMID:15967440] - Pfalz J,Liere K,Kandlbinder A,Dietz KJ,Oelmüller R
pTAC2, -6, and -12 are components of the transcriptionally active plastid chromosome that are required for plastid gene expression. Plant Cell, 2006. 18(1): p. 176-97 [PMID:16326926] - Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana. Genes Dev., 2006. 20(24): p. 3407-25 [PMID:17182867] - Zybailov B, et al.
Sorting signals, N-terminal modifications and abundance of the chloroplast proteome. PLoS ONE, 2008. 3(4): p. e1994 [PMID:18431481] - Maréchal A, et al.
Whirly proteins maintain plastid genome stability in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(34): p. 14693-8 [PMID:19666500] - Xiong JY, et al.
Recruitment of AtWHY1 and AtWHY3 by a distal element upstream of the kinesin gene AtKP1 to mediate transcriptional repression. Plant Mol. Biol., 2009. 71(4-5): p. 437-49 [PMID:19669906] - Cappadocia L, et al.
Crystal structures of DNA-Whirly complexes and their role in Arabidopsis organelle genome repair. Plant Cell, 2010. 22(6): p. 1849-67 [PMID:20551348] - Cappadocia L, et al.
A conserved lysine residue of plant Whirly proteins is necessary for higher order protein assembly and protection against DNA damage. Nucleic Acids Res., 2012. 40(1): p. 258-69 [PMID:21911368] - Miao Y,Jiang J,Ren Y,Zhao Z
The single-stranded DNA-binding protein WHIRLY1 represses WRKY53 expression and delays leaf senescence in a developmental stage-dependent manner in Arabidopsis. Plant Physiol., 2013. 163(2): p. 746-56 [PMID:23922267] - Lepage É,Zampini É,Brisson N
Plastid genome instability leads to reactive oxygen species production and plastid-to-nucleus retrograde signaling in Arabidopsis. Plant Physiol., 2013. 163(2): p. 867-81 [PMID:23969600] - Cappadocia L,Parent JS,Sygusch J,Brisson N
A family portrait: structural comparison of the Whirly proteins from Arabidopsis thaliana and Solanum tuberosum. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun., 2013. 69(Pt 11): p. 1207-11 [PMID:24192350] - Zampini É,Lepage É,Tremblay-Belzile S,Truche S,Brisson N
Organelle DNA rearrangement mapping reveals U-turn-like inversions as a major source of genomic instability in Arabidopsis and humans. Genome Res., 2015. 25(5): p. 645-54 [PMID:25800675] - Karpinska B,Alomrani SO,Foyer CH
Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling. Philos. Trans. R. Soc. Lond., B, Biol. Sci., 2018. [PMID:28808105]
|