![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G13570.1 | ||||||||
| Common Name | NFYB7, NF-YB7, T10F5.11 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 215aa MW: 24619.1 Da PI: 6.4165 | ||||||||
| Description | nuclear factor Y, subunit B7 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 179.3 | 3.4e-56 | 35 | 130 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
+eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plkvyl kyr++egek
AT2G13570.1 35 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLCKYRDTEGEK 130
89*******************************************************************************************997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.9E-54 | 28 | 163 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.02E-41 | 37 | 166 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.1E-28 | 40 | 104 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-18 | 68 | 86 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 71 | 87 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.3E-18 | 87 | 105 | No hit | No description |
| PRINTS | PR00615 | 2.3E-18 | 106 | 124 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025195 | anatomy | pollen tube cell | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001016 | developmental stage | L mature pollen stage | ||||
| PO:0001017 | developmental stage | M germinated pollen stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 215 aa Download sequence Send to blast |
MTEESPEEDH GSPGVAETNP GSPSSKTNNN NNNNKEQDRF LPIANVGRIM KKVLPGNGKI 60 SKDAKETVQE CVSEFISFVT GEASDKCQRE KRKTINGDDI IWAITTLGFE DYVAPLKVYL 120 CKYRDTEGEK VNSPKQQQQR QQQQQIQQQN HHNYQFQEQD QNNNNMSCTS YISHHHPSPF 180 LPVDHQPFPN IAFSPKSLQK QFPQQHDNNI DSIHW |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-44 | 35 | 125 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-44 | 35 | 125 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 263718_at | 0.0 | ||||
| Expression Atlas | AT2G13570 | - | ||||
| AtGenExpress | AT2G13570 | - | ||||
| ATTED-II | AT2G13570 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G13570.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT3G12480, AT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G07980, AT1G08970, AT1G09030, AT1G54830, AT1G56170 | |||||
| IntAct | Search Q9SIT9 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G13570 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC007063 | 0.0 | AC007063.6 Arabidopsis thaliana chromosome 2 clone T10F5 map PR1, complete sequence. | |||
| GenBank | BT025276 | 0.0 | BT025276.1 Arabidopsis thaliana At2g13570 mRNA, complete cds. | |||
| GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| GenBank | DQ446491 | 0.0 | DQ446491.1 Arabidopsis thaliana clone pENTR221-At2g13570 CCAAT-box binding transcription factor (At2g13570) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_178981.1 | 1e-160 | nuclear factor Y, subunit B7 | ||||
| Swissprot | Q9SIT9 | 1e-162 | NFYB7_ARATH; Nuclear transcription factor Y subunit B-7 | ||||
| TrEMBL | A0A384KFW4 | 1e-159 | A0A384KFW4_ARATH; NF-YB7 | ||||
| TrEMBL | A0MEK8 | 1e-159 | A0MEK8_ARATH; Uncharacterized protein (Fragment) | ||||
| TrEMBL | C0SV44 | 1e-159 | C0SV44_ARATH; Uncharacterized protein At2g13570 (Fragment) | ||||
| STRING | AT2G13570.1 | 1e-160 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 | Representative plant | OGRP168 | 17 | 170 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G13570.1 |
| Entrez Gene | 815843 |
| iHOP | AT2G13570 |
| wikigenes | AT2G13570 |




