![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G13960.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 150aa MW: 17056.4 Da PI: 8.6153 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 58.7 | 1.3e-18 | 75 | 121 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT+eEde l +av+++ g++Wk+Ia+ ++ Rt qc +rwqk+l
AT2G13960.1 75 KGGWTPEEDETLRRAVEKYKGKRWKKIAEFFP-ERTQVQCLHRWQKVL 121
688*****************************.************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.279 | 70 | 125 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 4.14E-19 | 72 | 133 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 5.8E-16 | 74 | 123 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 6.4E-17 | 75 | 121 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.2E-22 | 77 | 133 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 5.67E-15 | 78 | 121 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0025195 | anatomy | pollen tube cell | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001017 | developmental stage | M germinated pollen stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 150 aa Download sequence Send to blast |
MSSSSNPPVC SPEKEERSEM KIEIQCMENK QPLAASCSSA SEGSGCFFLK SPEIATPATV 60 SSFPRRTSGP MRRAKGGWTP EEDETLRRAV EKYKGKRWKK IAEFFPERTQ VQCLHRWQKV 120 LNPELVKGPW TQEVLLSFSC SETFFGFHFT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h88_C | 2e-19 | 74 | 133 | 5 | 64 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 2e-19 | 74 | 133 | 5 | 64 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.64926 | 0.0 | inflorescence | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 42569017 | 0.0 | ||||
| Genevisible | 265301_s_at | 1e-110 | ||||
| Expression Atlas | AT2G13960 | - | ||||
| AtGenExpress | AT2G13960 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed both in proliferating and maturing stages of leaves. {ECO:0000269|PubMed:26069325}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds 5'-AACGG-3' motifs in gene promoters (By similarity). Transcription repressor that regulates organ growth. Binds to the promoters of G2/M-specific genes and to E2F target genes to prevent their expression in post-mitotic cells and to restrict the time window of their expression in proliferating cells (PubMed:26069325). {ECO:0000250|UniProtKB:Q94FL9, ECO:0000269|PubMed:26069325}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G13960.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Slightly induced by ethylene and salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G13960 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT024758 | 0.0 | BT024758.1 Arabidopsis thaliana At2g13960 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_179013.2 | 1e-107 | Homeodomain-like superfamily protein | ||||
| Swissprot | Q6R032 | 6e-91 | MB3R5_ARATH; Transcription factor MYB3R-5 | ||||
| TrEMBL | Q29PZ8 | 1e-105 | Q29PZ8_ARATH; At2g13960 | ||||
| STRING | AT2G13960.1 | 1e-106 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM30442 | 2 | 2 | Representative plant | OGRP5 | 17 | 1784 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G13960.1 |
| Entrez Gene | 815880 |
| iHOP | AT2G13960 |
| wikigenes | AT2G13960 |




