![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G18350.1 | ||||||||
| Common Name | AtHB24, HB24, T30D6.14, ZHD6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 262aa MW: 29950.6 Da PI: 9.218 | ||||||||
| Description | homeobox protein 24 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 100.8 | 9.5e-32 | 79 | 133 | 3 | 58 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
k+rY+eC+kNhAas Ggh+vDGCgEfm+s geegt+++l CaAC+CHR+FHR+e +
AT2G18350.1 79 KARYRECQKNHAASSGGHVVDGCGEFMSS-GEEGTVESLLCAACDCHRSFHRKEID 133
689*************************9.999********************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 7.0E-40 | 67 | 142 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 6.3E-29 | 80 | 132 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 5.0E-31 | 81 | 132 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 26.786 | 82 | 131 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| SuperFamily | SSF46689 | 1.33E-17 | 185 | 259 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-28 | 191 | 260 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01565 | 9.5E-31 | 198 | 255 | IPR006455 | Homeodomain, ZF-HD class |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000014 | anatomy | rosette leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 262 aa Download sequence Send to blast |
MEVREKKDEK MEMTRRKSSA LDHHRLPPYT YSQTANKEKP TTKRNGSDPD PDPDLDTNPI 60 SISHAPRSYA RPQTTSPGKA RYRECQKNHA ASSGGHVVDG CGEFMSSGEE GTVESLLCAA 120 CDCHRSFHRK EIDGLFVVNF NSFGHSQRPL GSRHVSPIMM SFGGGGGCAA ESSTEDLNKF 180 HQSFSGYGVD QFHHYQPKKR FRTKFNEEQK EKMMEFAEKI GWRMTKLEDD EVNRFCREIK 240 VKRQVFKVWM HNNKQAAKKK DL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wh7_A | 2e-19 | 199 | 256 | 18 | 75 | ZF-HD homeobox family protein |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.40008 | 0.0 | flower| leaf| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 18398713 | 0.0 | ||||
| Genevisible | 265333_at | 0.0 | ||||
| Expression Atlas | AT2G18350 | - | ||||
| AtGenExpress | AT2G18350 | - | ||||
| ATTED-II | AT2G18350 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, stems, flowers and inflorescence. {ECO:0000269|PubMed:16428600}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription factor. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00268 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G18350.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT2G36610, AT5G65410, AT1G26960, AT1G69600 | |||||
| IntAct | Search Q9ZPW7 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G18350 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC006439 | 0.0 | AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence. | |||
| GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_565436.1 | 0.0 | homeobox protein 24 | ||||
| Swissprot | Q9ZPW7 | 0.0 | ZHD6_ARATH; Zinc-finger homeodomain protein 6 | ||||
| TrEMBL | A0A178VQS0 | 0.0 | A0A178VQS0_ARATH; ZHD6 | ||||
| STRING | AT2G18350.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6515 | 25 | 43 | Representative plant | OGRP91 | 16 | 237 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G18350.1 |
| Entrez Gene | 816350 |
| iHOP | AT2G18350 |
| wikigenes | AT2G18350 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




