![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G18550.1 | ||||||||
| Common Name | ATHB21, ATHB-21, F24H14.10, HB-2, HB21 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 220aa MW: 25700.7 Da PI: 5.1011 | ||||||||
| Description | homeobox protein 21 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 62.1 | 8.2e-20 | 62 | 115 | 4 | 57 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
++++++eq++ Le Fe ++++ e++ +LA++lgL+ rqV vWFqNrRa++k+
AT2G18550.1 62 KRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKN 115
45899***********************************************95 PP
| |||||||
| 2 | HD-ZIP_I/II | 122.4 | 2.2e-39 | 61 | 152 | 2 | 93 |
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
+kr+ls+eqv++LE sFe ++kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k++E +y++Lk+ay++ + e++rL++ev +L+e+l e
AT2G18550.1 61 RKRKLSDEQVRMLEISFEDDHKLESERKDRLASELGLDPRQVAVWFQNRRARWKNKRVEDEYTKLKNAYETTVVEKCRLDSEVIHLKEQLYE 152
8***************************************************************************************9976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 17.022 | 56 | 116 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 4.28E-18 | 59 | 123 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 3.0E-20 | 59 | 120 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 5.56E-17 | 61 | 117 | No hit | No description |
| Pfam | PF00046 | 4.9E-17 | 62 | 115 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.2E-20 | 63 | 122 | IPR009057 | Homeodomain-like |
| PRINTS | PR00031 | 1.4E-5 | 87 | 96 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 91 | 114 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 1.4E-5 | 96 | 112 | IPR000047 | Helix-turn-helix motif |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 220 aa Download sequence Send to blast |
MNNQNVDDHN LLLISQLYPN VYTPLVPQQG GEAKPTRRRK RKSKSVVVAE EGENEGNGWF 60 RKRKLSDEQV RMLEISFEDD HKLESERKDR LASELGLDPR QVAVWFQNRR ARWKNKRVED 120 EYTKLKNAYE TTVVEKCRLD SEVIHLKEQL YEAEREIQRL AKRVEGTLSN SPISSSVTIE 180 ANHTTPFFGD YDIGFDGEAD ENLLYSPDYI DGLDWMSQFM |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.52810 | 0.0 | flower | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 265983_at | 0.0 | ||||
| Expression Atlas | AT2G18550 | - | ||||
| AtGenExpress | AT2G18550 | - | ||||
| ATTED-II | AT2G18550 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a homeodomain leucine zipper class I (HD-Zip I) protein. | |||||
| UniProt | Probable transcription factor. {ECO:0000250}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G18550.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | Brassinosteroid | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT2G36610, AT3G19290, AT5G65410, AT1G69600 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G18550 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT031362 | 0.0 | BT031362.1 Arabidopsis thaliana unknown protein (At2g18550) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_179445.1 | 1e-164 | homeobox protein 21 | ||||
| Swissprot | Q9ZU70 | 1e-165 | ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21 | ||||
| TrEMBL | C0SV50 | 1e-162 | C0SV50_ARATH; Uncharacterized protein At2g18550 (Fragment) | ||||
| STRING | AT2G18550.1 | 1e-163 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM2208 | 26 | 77 | Representative plant | OGRP3776 | 10 | 25 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G18550.1 |
| Entrez Gene | 816370 |
| iHOP | AT2G18550 |
| wikigenes | AT2G18550 |




