PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G22630.1

Common Name

AGL17, T9I22.7

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 227aa MW: 26313.9 Da PI: 9.3102

Description

AGAMOUS-like 17

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G22630.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	83.7	1.2e-26	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +i++++ rqvtfskRr+g++KKA+EL +LCdaev++iifs+t+kly+++s AT2G22630.1 10 KIDDSTSRQVTFSKRRKGLIKKAKELAILCDAEVCLIIFSNTDKLYDFAS 59 79**********************************************86 PP
2	K-box	74.7	2.6e-25	81	171	9	99
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 + +++ + +q+e++ L++e+++Lq++ R+l G +L+ Ls+keLq++e+qLe sl+ iR k++++l+++i+el +k + +++en +L++k++ AT2G22630.1 81 NPASEVKFWQREAETLRQELHSLQENYRQLTGVELNGLSVKELQNIESQLEMSLRGIRMKREQILTNEIKELTRKRNLVHHENLELSRKVQ 171 567889***********************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	29.969	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-37	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	7.24E-37	2	73	No hit	No description
SuperFamily	SSF55455	1.03E-30	2	91	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-25	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.4E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.6E-25	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.5E-23	84	170	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.496	86	176	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0048578	Biological Process	positive regulation of long-day photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0006036	anatomy	root epidermis
PO:0009005	anatomy	root
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020123	anatomy	root cap
PO:0025181	anatomy	root elongation zone
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MGRGKIVIQK IDDSTSRQVT FSKRRKGLIK KAKELAILCD AEVCLIIFSN TDKLYDFASS 60 SVKSTIERFN TAKMEEQELM NPASEVKFWQ REAETLRQEL HSLQENYRQL TGVELNGLSV 120 KELQNIESQL EMSLRGIRMK REQILTNEIK ELTRKRNLVH HENLELSRKV QRIHQENVEL 180 YKKAYGTSNT NGLGHHELVD AVYESHAQVR LQLSQPEQSH YKTSSNS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	6e-18	1	69	1	69	MEF2C
5f28_B	6e-18	1	69	1	69	MEF2C
5f28_C	6e-18	1	69	1	69	MEF2C
5f28_D	6e-18	1	69	1	69	MEF2C
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	265351_at	0.0
Expression Atlas	AT2G22630	-
AtGenExpress	AT2G22630	-
ATTED-II	AT2G22630	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in roots.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a MADs domain containing protein involved in promoting flowering. Loss of function mutations show delayed flowering in long days and reduced levels of LFY and AP1 expression.
UniProt	Probable transcription factor.

Function -- GeneRIF ? help Back to Top
The activitiy of the flowering promoter, AGAMOUS-LIKE 17, acting in the photoperiod pathway of A. thaliana independently of FT, is reported. [PMID: 18363787]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G22630.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT5G15840 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G69120(A), AT5G61850(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT2G45660, AT3G57230, AT4G37940, AT1G48150
IntAct	Search Q38840

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G22630

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493558	0.0	AB493558.1 Arabidopsis thaliana At2g22630 mRNA for hypothetical protein, partial cds, clone: RAAt2g22630.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001324454.1	1e-167	AGAMOUS-like 17
Refseq	NP_179848.1	1e-167	AGAMOUS-like 17
Swissprot	Q38840	1e-168	AGL17_ARATH; Agamous-like MADS-box protein AGL17
TrEMBL	A0A384L577	1e-165	A0A384L577_ARATH; AGL17
TrEMBL	C0SV55	1e-165	C0SV55_ARATH; Uncharacterized protein At2g22630 (Fragment)
STRING	AT2G22630.1	1e-166	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM530	24	105
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G22630.1
Entrez Gene	816794
iHOP	AT2G22630
wikigenes	AT2G22630

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Burgeff C,Liljegren SJ,Tapia-L MADS-box gene expression in lateral primordia, meristems and differentiated tissues of Arabidopsis thaliana roots. Planta, 2002. 214(3): p. 365-72 [PMID:11855641] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Becker A,Theissen G The major clades of MADS-box genes and their role in the development and evolution of flowering plants. Mol. Phylogenet. Evol., 2003. 29(3): p. 464-89 [PMID:14615187] Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes. Plant J., 2004. 38(2): p. 366-79 [PMID:15078338] Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Gan Y,Filleur S,Rahman A,Gotensparre S,Forde BG Nutritional regulation of ANR1 and other root-expressed MADS-box genes in Arabidopsis thaliana. Planta, 2005. 222(4): p. 730-42 [PMID:16021502] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Han P,García-Ponce B,Fonseca-Salazar G,Alvarez-Buylla ER,Yu H AGAMOUS-LIKE 17, a novel flowering promoter, acts in a FT-independent photoperiod pathway. Plant J., 2008. 55(2): p. 253-65 [PMID:18363787] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Rounsley SD,Ditta GS,Yanofsky MF Diverse roles for MADS box genes in Arabidopsis development. Plant Cell, 1995. 7(8): p. 1259-69 [PMID:7549482] Zachgo S,Saedler H,Schwarz-Sommer Z Pollen-specific expression of DEFH125, a MADS-box transcription factor in Antirrhinum with unusual features. Plant J., 1997. 11(5): p. 1043-50 [PMID:9193074] Heard J,Caspi M,Dunn K Evolutionary diversity of symbiotically induced nodule MADS box genes: characterization of nmhC5, a member of a novel subfamily. Mol. Plant Microbe Interact., 1997. 10(5): p. 665-76 [PMID:9204570] Carmona MJ,Ortega N,Garcia-Maroto F Isolation and molecular characterization of a new vegetative MADS-box gene from Solanum tuberosum L. Planta, 1998. 207(2): p. 181-8 [PMID:9951721]