| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | zf-B_box | 29.7 | 1.3e-09 | 5 | 47 | 3 | 39 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
r C+ +++ ++lfC+ + +lC dC ++H H++
AT2G24790.1 5 SRLCDSCKSTAATLFCRADAAFLCGDCDGKIHTAnklasrHER 47
689******99*********************55666767765 PP
|
| 2 | zf-B_box | 27.8 | 5.1e-09 | 48 | 93 | 3 | 42 |
zf-B_box 3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
+ C+ +e+ +++ C+ + lC +C +H+ H++vp+
AT2G24790.1 48 VWLCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplsrrHERVPI 93
689*****************************66899999*99997 PP
|
| 3 | CCT | 69.6 | 7.8e-24 | 229 | 272 | 1 | 44 |
CCT 1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44
Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
AT2G24790.1 229 REARVLRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 272
9*****************************************97 PP
|
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Robson F, et al.
Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J., 2001. 28(6): p. 619-31 [PMID:11851908] - Izawa T,Takahashi Y,Yano M
Comparative biology comes into bloom: genomic and genetic comparison of flowering pathways in rice and Arabidopsis. Curr. Opin. Plant Biol., 2003. 6(2): p. 113-20 [PMID:12667866] - Griffiths S,Dunford RP,Coupland G,Laurie DA
The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol., 2003. 131(4): p. 1855-67 [PMID:12692345] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Lu Y,Zhu J,Liu P
A two-step strategy for detecting differential gene expression in cDNA microarray data. Curr. Genet., 2005. 47(2): p. 121-31 [PMID:15688252] - Zobell O,Coupland G,Reiss B
The family of CONSTANS-like genes in Physcomitrella patens. Plant Biol (Stuttg), 2005. 7(3): p. 266-75 [PMID:15912446] - Fukamatsu Y, et al.
Identification of LOV KELCH PROTEIN2 (LKP2)-interacting factors that can recruit LKP2 to nuclear bodies. Plant Cell Physiol., 2005. 46(8): p. 1340-9 [PMID:15937324] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Datta S,Hettiarachchi GH,Deng XW,Holm M
Arabidopsis CONSTANS-LIKE3 is a positive regulator of red light signaling and root growth. Plant Cell, 2006. 18(1): p. 70-84 [PMID:16339850] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] - Manzano C,Abraham Z,L
Identification of ubiquitinated proteins in Arabidopsis. Plant Mol. Biol., 2008. 68(1-2): p. 145-58 [PMID:18535787] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Khanna R, et al.
The Arabidopsis B-box zinc finger family. Plant Cell, 2009. 21(11): p. 3416-20 [PMID:19920209] - Tripathi P,Carvallo M,Hamilton EE,Preuss S,Kay SA
Arabidopsis B-BOX32 interacts with CONSTANS-LIKE3 to regulate flowering. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(1): p. 172-177 [PMID:27999181]
|