PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G26320.1

Common Name

AGL33

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 109aa MW: 12975.5 Da PI: 10.7686

Description

AGAMOUS-like 33

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G26320.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	55.2	8.9e-18	25	69	1	45
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 krie+ r+ fskR++g++KKAeE+ LCd ++ +i++s+t k AT2G26320.1 25 KRIESLKERSSKFSKRKKGLFKKAEEVALLCDSDIMLIVVSPTEK 69 79****************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.4E-27	17	76	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	21.754	17	77	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	4.71E-22	17	95	IPR002100	Transcription factor, MADS-box
CDD	cd00266	1.53E-22	18	100	No hit	No description
PRINTS	PR00404	1.4E-14	19	39	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.9E-18	26	73	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-14	39	54	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-14	54	75	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MKRTIKNKNK QIVKENMGRK KLKLKRIESL KERSSKFSKR KKGLFKKAEE VALLCDSDIM 60 LIVVSPTEKP TVFNTRSRSF HTILERFCML SLQEREERCD LSYFYIIIT

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	18401093	0.0
Genevisible	267403_at	1e-131
Expression Atlas	AT2G26320	-
AtGenExpress	AT2G26320	-
ATTED-II	AT2G26320	-

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G26320.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G26320

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY141233	0.0	AY141233.1 Arabidopsis thaliana MADS-box protein AGL33 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_180200.1	6e-73	AGAMOUS-like 33
TrEMBL	O64840	1e-71	O64840_ARATH; AGAMOUS-like 33
STRING	AT2G26320.1	2e-72	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7330	18	38
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G26320.1
Entrez Gene	817172
iHOP	AT2G26320
wikigenes	AT2G26320

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] De Bodt S,Raes J,Van de Peer Y,Theissen G And then there were many: MADS goes genomic. Trends Plant Sci., 2003. 8(10): p. 475-83 [PMID:14557044] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Day RC,Herridge RP,Ambrose BA,Macknight RC Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020]