PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G26580.1
Common NameT9J22.25, YAB5
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family YABBY
Protein Properties Length: 164aa    MW: 18505.2 Da    PI: 9.6388
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G26580.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY76.77.6e-24562461
        YABBY  4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61
                 + ++eq+Cy+ CnfCn ilav+vP +slf +vtvrCGhCt+l svn+a a q l+  +
  AT2G26580.1  5 VMATEQLCYIPCNFCNIILAVNVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPN 62
                 6789*******************************************99998887654 PP
2YABBY134.51.3e-417115387170
        YABBY  87 ekeesastsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                   ++ s+s+s+++   s+ +++ ++++  v+rPPekrqrvPsayn+fikeeiqrika+nPdishreafs+aaknWahfP+ihfgl
  AT2G26580.1  71 PEYGSSSRSHTKIP-SRISTRTITEQRIVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHFPHIHFGL 153
                  44444555544433.6777888888888******************************************************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.7E-697153IPR006780YABBY protein
SuperFamilySSF470953.67E-897146IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.0E-4100147IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MANSVMATEQ LCYIPCNFCN IILAVNVPCS SLFDIVTVRC GHCTNLWSVN MAAALQSLSR  60
PNFQATNYAV PEYGSSSRSH TKIPSRISTR TITEQRIVNR PPEKRQRVPS AYNQFIKEEI  120
QRIKANNPDI SHREAFSTAA KNWAHFPHIH FGLMLESNKQ AKIA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.388740.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245029_at5e-95
Expression AtlasAT2G26580-
AtGenExpressAT2G26580-
ATTED-IIAT2G26580-
Functional Description ? help Back to Top
Source Description
UniProtPromotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}.
Function -- GeneRIF ? help Back to Top
  1. Nozzle protein bound filamentous flower and yabby3. (nozzle protein) in Arabidopsis.
    [PMID: 15299139]
  2. YAB5 interact with LUG and LUH. Together these proteins maintain leaf polarity and meristem activity in Arabidopsis.
    [PMID: 19837869]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G26580.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source Upstream Regulator (A: Activate/R: Repress)
ATRM AT1G65620 (R), AT2G37630 (R)
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Leaves polarity and growth defects. {ECO:0000269|PubMed:19837869}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G26580
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1190910.0AK119091.1 Arabidopsis thaliana At2g26580 mRNA for unknown protein, complete cds, clone: RAFL21-44-F19.
GenBankBT0037340.0BT003734.1 Arabidopsis thaliana At2g26580 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850080.11e-120plant-specific transcription factor YABBY family protein
RefseqNP_850081.11e-120plant-specific transcription factor YABBY family protein
SwissprotQ8GW461e-121YAB5_ARATH; Axial regulator YABBY 5
TrEMBLA0A178VPK41e-119A0A178VPK4_ARATH; YAB5
STRINGAT2G26580.11e-120(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM55382649
Representative plantOGRP22101236
Publications ? help Back to Top
  1. Bowman JL
    The YABBY gene family and abaxial cell fate.
    Curr. Opin. Plant Biol., 2000. 3(1): p. 17-22
    [PMID:10679447]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  4. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Navarro C, et al.
    Molecular and genetic interactions between STYLOSA and GRAMINIFOLIA in the control of Antirrhinum vegetative and reproductive development.
    Development, 2004. 131(15): p. 3649-59
    [PMID:15229173]
  7. Sieber P,Petrascheck M,Barberis A,Schneitz K
    Organ polarity in Arabidopsis. NOZZLE physically interacts with members of the YABBY family.
    Plant Physiol., 2004. 135(4): p. 2172-85
    [PMID:15299139]
  8. Izhaki A,Bowman JL
    KANADI and class III HD-Zip gene families regulate embryo patterning and modulate auxin flow during embryogenesis in Arabidopsis.
    Plant Cell, 2007. 19(2): p. 495-508
    [PMID:17307928]
  9. Iwakawa H, et al.
    Expression of the ASYMMETRIC LEAVES2 gene in the adaxial domain of Arabidopsis leaves represses cell proliferation in this domain and is critical for the development of properly expanded leaves.
    Plant J., 2007. 51(2): p. 173-84
    [PMID:17559509]
  10. Takahashi H, et al.
    Knowledge-based fuzzy adaptive resonance theory and its application to the analysis of gene expression in plants.
    J. Biosci. Bioeng., 2008. 106(6): p. 587-93
    [PMID:19134556]
  11. Stahle MI,Kuehlich J,Staron L,von Arnim AG,Golz JF
    YABBYs and the transcriptional corepressors LEUNIG and LEUNIG_HOMOLOG maintain leaf polarity and meristem activity in Arabidopsis.
    Plant Cell, 2009. 21(10): p. 3105-18
    [PMID:19837869]
  12. Kojima S, et al.
    Asymmetric leaves2 and Elongator, a histone acetyltransferase complex, mediate the establishment of polarity in leaves of Arabidopsis thaliana.
    Plant Cell Physiol., 2011. 52(8): p. 1259-73
    [PMID:21700721]
  13. Bartholmes C,Hidalgo O,Gleissberg S
    Evolution of the YABBY gene family with emphasis on the basal eudicot Eschscholzia californica (Papaveraceae).
    Plant Biol (Stuttg), 2012. 14(1): p. 11-23
    [PMID:21974722]
  14. Chen GH,Sun JY,Liu M,Liu J,Yang WC
    SPOROCYTELESS is a novel embryophyte-specific transcription repressor that interacts with TPL and TCP proteins in Arabidopsis.
    J Genet Genomics, 2014. 41(12): p. 617-25
    [PMID:25527103]
  15. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  16. Husbands AY,Benkovics AH,Nogueira FT,Lodha M,Timmermans MC
    The ASYMMETRIC LEAVES Complex Employs Multiple Modes of Regulation to Affect Adaxial-Abaxial Patterning and Leaf Complexity.
    Plant Cell, 2015. 27(12): p. 3321-35
    [PMID:26589551]