PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G30424.1
Common NameCPL4, T6B20, TCL2
Organism
Arabidopsis thaliana
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 100aa    MW: 12219 Da    PI: 10.5997
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G30424.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.41.6e-083675445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ + +++ G + W++Ia ++  gR +k++  +w 
      AT2G30424.1 36 MTEQEEDLIFRMHRLVGDR-WDLIAGRVV-GREAKDIERYWI 75
                     7****************99.*********.***********5 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007177.8E-43280IPR001005SANT/Myb domain
CDDcd001671.58E-53574No hitNo description
Gene3DG3DSA:1.10.10.608.3E-103675IPR009057Homeodomain-like
PfamPF002496.1E-83675IPR001005SANT/Myb domain
SuperFamilySSF466891.63E-63775IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0020030anatomycotyledon
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MDNTNRLRHL RSRKQSKFTL GDTAEVNSVK WEFINMTEQE EDLIFRMHRL VGDRWDLIAG  60
RVVGREAKDI ERYWIMRNCD HCSHKRRRVH KFYRFSISPP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18488KRRRV
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267495_at1e-48
Expression AtlasAT2G30424-
AtGenExpressAT2G30424-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in cotyledons, petioles, rosette leaves, hydathodes, cauline leaves, stems, pedicels and flower buds. {ECO:0000269|PubMed:22168948, ECO:0000269|PubMed:22489163}.
Functional Description ? help Back to Top
Source Description
TAIRIn a tandem repeat with AT2g30432 (TCL1) and AT2g30420 (ETC2)
UniProtMYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}.
Function -- GeneRIF ? help Back to Top
  1. TCL2 function redundantly with TCL1 in controlling trichome formation on inflorescences, but they are not fully functional equivalent. Transcription of TCL2 is controlled by miR156-activated transcription factors.
    [PMID: 22168948]
  2. We independently identified CPC-LIKE MYB4 (CPL4), which was found to be identical to TCL2. RT-PCR analysis showed that CPL4 is strongly expressed in shoots, including true leaves, but not in roots.
    [PMID: 22489163]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G30424.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G30424
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026858e-75CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankFJ9726778e-75FJ972677.1 Arabidopsis thaliana ecotype Gr-1 trichomeless2 (TCL2) gene, complete cds.
GenBankFJ9726798e-75FJ972679.1 Arabidopsis thaliana ecotype Oy-0 trichomeless2 (TCL2) gene, complete cds.
GenBankFJ9726808e-75FJ972680.1 Arabidopsis thaliana ecotype Landsberg erecta trichomeless2 (TCL2) gene, complete cds.
GenBankFJ9726818e-75FJ972681.1 Arabidopsis thaliana ecotype Col-0 trichomeless2 (TCL2) gene, complete cds.
GenBankU932158e-75U93215.3 Arabidopsis thaliana chromosome 2 BAC T6B20 genomic sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001118417.14e-70Homeodomain-like superfamily protein
SwissprotB3H4X83e-71TCL2_ARATH; MYB-like transcription factor TCL2
TrEMBLA0A178VT138e-69A0A178VT13_ARATH; TCL2
STRINGAT2G30424.11e-69(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Representative plantOGRP4207823
Publications ? help Back to Top
  1. Hilscher J,Schlötterer C,Hauser MT
    A single amino acid replacement in ETC2 shapes trichome patterning in natural Arabidopsis populations.
    Curr. Biol., 2009. 19(20): p. 1747-51
    [PMID:19818620]
  2. Gan L,Xia K,Chen JG,Wang S
    Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis.
    BMC Plant Biol., 2011. 11: p. 176
    [PMID:22168948]
  3. Tominaga-Wada R,Nukumizu Y
    Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
    Int J Mol Sci, 2012. 13(3): p. 3478-91
    [PMID:22489163]
  4. Tominaga-Wada R,Nukumizu Y,Sato S,Wada T
    Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor.
    PLoS ONE, 2013. 8(1): p. e54019
    [PMID:23326563]
  5. Nukumizu Y,Wada T,Tominaga-Wada R
    Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation.
    Plant Signal Behav, 2013. 8(7): p. e24575
    [PMID:23603939]
  6. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  7. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]