PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G30432.1

Common Name

T6B20, TCL1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB_related

Protein Properties

Length: 84aa MW: 10494 Da PI: 9.2388

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G30432.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	27.2	9e-09	35	74	4	45
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+ + ++ G + W++Iar++ gR +k++ +w AT2G30432.1 35 MTEQEEDLIFRMYRLVGDR-WDLIARRVV-GREAKEIERYWI 74 7**************99.*****.*********5 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	4.1E-4	31	79	IPR001005	SANT/Myb domain
CDD	cd00167	1.93E-5	34	73	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.1E-9	35	74	IPR009057	Homeodomain-like
Pfam	PF00249	7.8E-8	35	74	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	6.32E-7	36	74	IPR009057	Homeodomain-like
PROSITE profile	PS50090	6.133	36	73	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:2000039	Biological Process	regulation of trichome morphogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MDNTNRLRRL HCHKQPKFTH SSQEVSSMKW EFINMTEQEE DLIFRMYRLV GDRWDLIARR 60 VVGREAKEIE RYWIMRNCDY FSHK

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.49556	1e-85	silique

Expression -- Microarray ? help Back to Top
Source	ID
Expression Atlas	AT2G30432
AtGenExpress	AT2G30432

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in inflorescences and trichomes of rosette and cauline leaves. {ECO:0000269\|PubMed:20622149}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes TRICHOMELESS1 (TCL1), a single-repeat MYB-type transcription factor that negatively regulates trichome formation by suppressing GL1 (GLABRA1). In a tandem repeat with AT2g30424 and AT2g30420.
UniProt	MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1. {ECO:0000269\|PubMed:17933793}.

Function -- GeneRIF ? help Back to Top
TRICHOMELESS1 can be recruited to the cis-acting regulatory elements of GLABRA1 [PMID: 17933793] NTL8 negatively regulates trichome formation in Arabidopsis by directly activating the expression of TRY and TCL1. [PMID: 28649093]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G30432.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT2G42200 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT3G27920(R)

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Trichome formation on inflorescence stems and pedicels. {ECO:0000269\|PubMed:17933793}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G30432

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ108777	1e-140	DQ108777.1 Arabidopsis thaliana clone 22671 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001031445.1	5e-58	Homeodomain-like superfamily protein
Swissprot	D3GKW6	4e-59	TCL1_ARATH; MYB-like transcription factor TCL1
TrEMBL	A0A178VV20	1e-56	A0A178VV20_ARATH; TCL1
STRING	AT2G30432.1	2e-57	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM323	28	194
Representative plant	OGRP4207	8	23

Link Out ? help Back to Top
Phytozome	AT2G30432.1
Entrez Gene	3768521
iHOP	AT2G30432
wikigenes	AT2G30432

Publications ? help Back to Top
Alexandrov NN, et al. Features of Arabidopsis genes and genome discovered using full-length cDNAs. Plant Mol. Biol., 2006. 60(1): p. 69-85 [PMID:16463100] Wang S, et al. TRICHOMELESS1 regulates trichome patterning by suppressing GLABRA1 in Arabidopsis. Development, 2007. 134(21): p. 3873-82 [PMID:17933793] Hilscher J,Schlötterer C,Hauser MT A single amino acid replacement in ETC2 shapes trichome patterning in natural Arabidopsis populations. Curr. Biol., 2009. 19(20): p. 1747-51 [PMID:19818620] Yu N, et al. Temporal control of trichome distribution by microRNA156-targeted SPL genes in Arabidopsis thaliana. Plant Cell, 2010. 22(7): p. 2322-35 [PMID:20622149] Gan L,Xia K,Chen JG,Wang S Functional characterization of TRICHOMELESS2, a new single-repeat R3 MYB transcription factor in the regulation of trichome patterning in Arabidopsis. BMC Plant Biol., 2011. 11: p. 176 [PMID:22168948] Tominaga-Wada R,Nukumizu Y Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis. Int J Mol Sci, 2012. 13(3): p. 3478-91 [PMID:22489163] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Tominaga-Wada R,Nukumizu Y,Sato S,Wada T Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor. PLoS ONE, 2013. 8(1): p. e54019 [PMID:23326563] Nukumizu Y,Wada T,Tominaga-Wada R Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation. Plant Signal Behav, 2013. 8(7): p. e24575 [PMID:23603939] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Zheng K, et al. Ectopic expression of R3 MYB transcription factor gene OsTCL1 in Arabidopsis, but not rice, affects trichome and root hair formation. Sci Rep, 2016. 6: p. 19254 [PMID:26758286] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tian H, et al. NTL8 Regulates Trichome Formation in Arabidopsis by Directly Activating R3 MYB Genes TRY and TCL1. Plant Physiol., 2017. 174(4): p. 2363-2375 [PMID:28649093]