![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G33880.1 | ||||||||
| Common Name | HB-3, STIP, T1B8.31, WOX9, WOX9A | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 378aa MW: 42089.2 Da PI: 9.0578 | ||||||||
| Description | homeobox-3 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 56.6 | 4.3e-18 | 53 | 113 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
++R+++++eq+++Le+ F++ +p +ee++++ ++l ++ +++V++WFqNr+ + k+
AT2G33880.1 53 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 113
89*****************99*************************************995 PP
| |||||||
| 2 | Wus_type_Homeobox | 112.4 | 2.4e-36 | 52 | 114 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
+++RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
AT2G33880.1 52 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 114
689**********************************************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 10.689 | 49 | 114 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 3.55E-12 | 50 | 117 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 1.2E-8 | 51 | 118 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 2.13E-8 | 52 | 114 | No hit | No description |
| Pfam | PF00046 | 8.7E-16 | 53 | 113 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-6 | 53 | 112 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0008284 | Biological Process | positive regulation of cell proliferation | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009793 | Biological Process | embryo development ending in seed dormancy | ||||
| GO:0010075 | Biological Process | regulation of meristem growth | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000229 | anatomy | flower meristem | ||||
| PO:0002002 | anatomy | embryo basal cell | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020003 | anatomy | plant ovule | ||||
| PO:0020109 | anatomy | embryo hypophysis | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 378 aa Download sequence Send to blast |
MASSNRHWPS MFKSKPHPHQ WQHDINSPLL PSASHRSSPF SSGCEVERSP EPKPRWNPKP 60 EQIRILEAIF NSGMVNPPRE EIRRIRAQLQ EYGQVGDANV FYWFQNRKSR SKHKLRLLHN 120 HSKHSLPQTQ PQPQPQPSAS SSSSSSSSSS KSTKPRKSKN KNNTNLSLGG SQMMGMFPPE 180 PAFLFPVSTV GGFEGITVSS QLGFLSGDMI EQQKPAPTCT GLLLSEIMNG SVSYGTHHQQ 240 HLSEKEVEEM RMKMLQQPQT QICYATTNHQ IASYNNNNNN NNIMLHIPPT TSTATTITTS 300 HSLATVPSTS DQLQVQADAR IRVFINEMEL EVSSGPFNVR DAFGEEVVLI NSAGQPIVTD 360 EYGVALHPLQ HGASYYLI |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.14699 | 0.0 | bud| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 186505136 | 0.0 | ||||
| Genevisible | 267453_at | 0.0 | ||||
| Expression Atlas | AT2G33880 | - | ||||
| AtGenExpress | AT2G33880 | - | ||||
| ATTED-II | AT2G33880 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: First detected in the basal daughter cell of the zygote (PubMed:14711878). Unlike WOX2 and WOX8, it is not expressed in the egg cell or the zygote (PubMed:14711878). During two subsequent rounds of transverse cell divisions, it is restricted to the hypophysis (PubMed:14711878). At the 8-cell stage, it expands into the central domain of the embryo, in addition to weakening in the hypophysis (PubMed:14711878). After protoderm formation, expression in the central embryo domain is restricted to the protodermal cells and also disappears from the hypophyseal cell (PubMed:14711878). In subsequent stages, a ring of expression remains at the presumptive boundary between root and hypocotyl, at about the same position as WOX2 expression in heart stage embryos (PubMed:14711878). In addition to its embryonic expression, it is expressed postembryonically in the epidermal cells of the placenta during gynoecium development, but not in the developing ovules (PubMed:14711878). The placental expression disappears soon after fertilization (PubMed:14711878). Expression dynamics require MP and BDL, but not GN activity (PubMed:14711878). Detected as early as the first zygotic division in both the apical and the basal daughter cells (PubMed:17706632). By late globular to early transition stage, the protein is evenly distributed through out the embryo and the suspensor (PubMed:17706632). The basal half of the embryo, especially cells in the protoderm layer, starts to show slightly higher levels of expression by early heart stage (PubMed:17706632). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:17706632}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the basal cell and later at the boundary between suspensor and proembryo (PubMed:14711878). Expressed at low levels in proliferating tissues post embryonically (PubMed:15753038). Detected in vegetative shoot apical meristem, leaf primordia, floral meristems, emerging floral organs, epidermal layer of the placenta and in the upper portion of the root meristematic zone (PubMed:15753038, PubMed:20110319). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:20110319}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced root development and smaller meristems. Phenotypes can be rescued by addition of sucrose in the growth media. Overexpression can partially rescue the triple mutant cytokinin receptor phenotype suggesting HB-3 is a downstream effector of cytokinin signaling. | |||||
| UniProt | Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G33880.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Target Gene (A: Activate/R: Repress) | |||||
| ATRM | AT2G17950(A), AT3G11260(A) | |||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT3G18380, AT5G08330, AT5G16560, AT5G60120, AT1G14920 | |||||
| IntAct | Search Q6X7J4 | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: Embryonic lethality when homozygous (PubMed:17706632). Reduction in embryonic growth, failure in axillary shoot apical meristem and leaf-primordia initiation and growth, and failure in primary root growth and lateral root initiation when heterozygous (PubMed:15753038, PubMed:17706632). Wox8 and wox9 double mutants are embryo lethal, with embryos disrupted as early as the first cell division in the embryo proper (PubMed:17706632). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G33880 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY251401 | 0.0 | AY251401.1 Arabidopsis thaliana WOX9 protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_180944.2 | 0.0 | homeobox-3 | ||||
| Swissprot | Q6X7J4 | 0.0 | WOX9_ARATH; WUSCHEL-related homeobox 9 | ||||
| TrEMBL | A0A178VQA8 | 0.0 | A0A178VQA8_ARATH; Homeobox-3 | ||||
| TrEMBL | A0A384KQD3 | 0.0 | A0A384KQD3_ARATH; WOX9A | ||||
| STRING | AT2G33880.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM7206 | 26 | 40 | Representative plant | OGRP6103 | 12 | 20 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G33880.1 |
| Entrez Gene | 817958 |
| iHOP | AT2G33880 |
| wikigenes | AT2G33880 |




