PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G34140.1

Common Name

CDF4, DOF2.3, T14G11.26

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Dof

Protein Properties

Length: 170aa MW: 18926.5 Da PI: 9.5953

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G34140.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	124.3	4e-39	54	112	2	60
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k AT2G34140.1 54 PDKIIACPRCKSMETKFCYFNNYNVNQPRHFCKGCHRYWTAGGALRNVPVGAGRRKSKP 112 68999***************************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-30	53	111	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	4.6E-32	56	111	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.127	58	112	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	60	96	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009908	Biological Process	flower development
GO:0045892	Biological Process	negative regulation of transcription, DNA-templated
GO:1902455	Biological Process	negative regulation of stem cell population maintenance
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009029	anatomy	stamen
PO:0009046	anatomy	flower
PO:0020100	anatomy	hypocotyl
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 170 aa Download sequence Send to blast
MATQDSQGIK LFGKTIAFNT RTIKNEEETH PPEQEATIAV RSSSSSDLTA EKRPDKIIAC 60 PRCKSMETKF CYFNNYNVNQ PRHFCKGCHR YWTAGGALRN VPVGAGRRKS KPPGRVVVGM 120 LGDGNGVRQV ELINGLLVEE WQHAAAAAHG SFRHDFPMKR LRCYSDGQSC

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	256720_at	0.0
Expression Atlas	AT2G34140	-
AtGenExpress	AT2G34140	-
ATTED-II	AT2G34140	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269\|PubMed:19619493}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G34140.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G34140

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC002341	0.0	AC002341.3 Arabidopsis thaliana chromosome 2 clone T14G11 map TEn5, complete sequence.
GenBank	AK221308	0.0	AK221308.1 Arabidopsis thaliana mRNA for putative DOF zinc finger protein, complete cds, clone: RAFL25-04-B19.
GenBank	BT010496	0.0	BT010496.1 Arabidopsis thaliana At2g34140 gene, complete cds.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_180961.1	1e-127	Dof-type zinc finger DNA-binding family protein
Swissprot	O22967	1e-128	CDF4_ARATH; Cyclic dof factor 4
TrEMBL	A0A178VWS9	1e-125	A0A178VWS9_ARATH; Uncharacterized protein
STRING	AT2G34140.1	1e-127	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2809	26	69
Representative plant	OGRP38	17	445

Link Out ? help Back to Top
Phytozome	AT2G34140.1
Entrez Gene	817975
iHOP	AT2G34140
wikigenes	AT2G34140

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yanagisawa S The Dof family of plant transcription factors. Trends Plant Sci., 2002. 7(12): p. 555-60 [PMID:12475498] Lijavetzky D,Carbonero P,Vicente-Carbajosa J Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families. BMC Evol. Biol., 2003. 3: p. 17 [PMID:12877745] Kersten B, et al. Generation of Arabidopsis protein chips for antibody and serum screening. Plant Mol. Biol., 2003. 52(5): p. 999-1010 [PMID:14558660] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Rogers LA, et al. Comparison of lignin deposition in three ectopic lignification mutants. New Phytol., 2005. 168(1): p. 123-40 [PMID:16159327] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Fornara F, et al. Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response. Dev. Cell, 2009. 17(1): p. 75-86 [PMID:19619493] Shin R,Jez JM,Basra A,Zhang B,Schachtman DP 14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] Pi L, et al. Organizer-Derived WOX5 Signal Maintains Root Columella Stem Cells through Chromatin-Mediated Repression of CDF4 Expression. Dev. Cell, 2015. 33(5): p. 576-88 [PMID:26028217] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]