PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G34440.1

Common Name

AGL29

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 172aa MW: 19753.3 Da PI: 7.417

Description

AGAMOUS-like 29

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G34440.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	60.7	1.8e-19	12	57	4	49
-SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 ++ rqvtfskRr+g++KKA+EL +LC+ae +++fs+ gk + y AT2G34440.1 12 QDMNTRQVTFSKRRTGLFKKASELATLCNAELGIVVFSPGGKPFSY 57 56778**********************************9996665 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	25.02	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.89E-26	1	71	IPR002100	Transcription factor, MADS-box
SMART	SM00432	2.1E-32	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-19	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-23	12	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-19	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-19	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0000423	anatomy	plant zygote
PO:0005660	anatomy	hydathode
PO:0009046	anatomy	flower
PO:0009089	anatomy	endosperm
PO:0025195	anatomy	pollen tube cell
PO:0025281	anatomy	pollen
PO:0001016	developmental stage	L mature pollen stage
PO:0001017	developmental stage	M germinated pollen stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 172 aa Download sequence Send to blast
MGRRKIKMEM VQDMNTRQVT FSKRRTGLFK KASELATLCN AELGIVVFSP GGKPFSYGKP 60 NLDSVAERFM REYDDSDSGD EEKSGNYRPK LKRLSERLDL LNQEVEAEKE RGEKSQEKLE 120 SAGDERFKES IETLTLDELN EYKDRLQTVH GRIEGQVNHL QASSCLMLLS RK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	8e-16	1	69	1	69	MEF2 CHIMERA
6byy_B	8e-16	1	69	1	69	MEF2 CHIMERA
6byy_C	8e-16	1	69	1	69	MEF2 CHIMERA
6byy_D	8e-16	1	69	1	69	MEF2 CHIMERA
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	266994_at	0.0
Expression Atlas	AT2G34440	-
AtGenExpress	AT2G34440	-
ATTED-II	AT2G34440	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryogenesis, expressed in the chalazal endosperm. {ECO:0000269\|PubMed:20631316}.
Uniprot	TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269\|PubMed:12949148}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G34440.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G34440

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC004077	0.0	AC004077.3 Arabidopsis thaliana chromosome 2 clone T31E10 map ve016, complete sequence.
GenBank	AC004481	0.0	AC004481.3 Arabidopsis thaliana chromosome 2 clone F13P17 map ve016, complete sequence.
GenBank	CP002685	0.0	CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_180991.1	1e-123	AGAMOUS-like 29
Swissprot	O64703	1e-125	AGL29_ARATH; Agamous-like MADS-box protein AGL29
TrEMBL	A0A178VU29	1e-122	A0A178VU29_ARATH; AGL29
STRING	AT2G34440.1	1e-123	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM86	28	390
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT2G34440.1
Entrez Gene	818007
iHOP	AT2G34440
wikigenes	AT2G34440

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Becker JD,Boavida LC,Carneiro J,Haury M,Feij Transcriptional profiling of Arabidopsis tissues reveals the unique characteristics of the pollen transcriptome. Plant Physiol., 2003. 133(2): p. 713-25 [PMID:14500793] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]