![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G34720.1 | ||||||||
| Common Name | NFYA4, NF-YA4, T29F13.7 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 198aa MW: 22258.7 Da PI: 9.2692 | ||||||||
| Description | nuclear factor Y, subunit A4 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 100.3 | 2e-31 | 97 | 153 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rakle++++ +k++kpy+heSRh hA+rRpRg+gGrF
AT2G34720.1 97 EEPVFVNAKQYHGILRRRQSRAKLEARNRA-IKAKKPYMHESRHLHAIRRPRGCGGRF 153
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 2.9E-35 | 95 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.988 | 96 | 156 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.4E-26 | 98 | 153 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 9.8E-24 | 99 | 121 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 101 | 121 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 9.8E-24 | 130 | 153 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000293 | anatomy | guard cell | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 198 aa Download sequence Send to blast |
MTSSVHELSD NNESHAKKER PDSQTRPQVP SGRSSESIDT NSVYSEPMAH GLYPYPDPYY 60 RSVFAQQAYL PHPYPGVQLQ LMGMQQPGVP LQCDAVEEPV FVNAKQYHGI LRRRQSRAKL 120 EARNRAIKAK KPYMHESRHL HAIRRPRGCG GRFLNAKKEN GDHKEEEEAT SDENTSEASS 180 SLRSEKLAMA TSGPNGRS |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 5e-20 | 96 | 166 | 1 | 71 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.37769 | 0.0 | flower| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 186505349 | 0.0 | ||||
| Genevisible | 267315_at | 0.0 | ||||
| Expression Atlas | AT2G34720 | - | ||||
| AtGenExpress | AT2G34720 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in stems, caulines, and senescent flowers. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G34720.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT3G10800, AT3G48590, AT4G14540, AT5G50480, AT5G63470, AT1G08970, AT1G54830, AT1G56170 | |||||
| IntAct | Search Q8VY64 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G34720 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY072414 | 0.0 | AY072414.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds. | |||
| GenBank | AY114711 | 0.0 | AY114711.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_850235.1 | 1e-146 | nuclear factor Y, subunit A4 | ||||
| Swissprot | Q8VY64 | 1e-147 | NFYA4_ARATH; Nuclear transcription factor Y subunit A-4 | ||||
| TrEMBL | A0A178VWS5 | 1e-145 | A0A178VWS5_ARATH; NF-YA4 | ||||
| STRING | AT2G34720.1 | 1e-146 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4168 | 27 | 56 | Representative plant | OGRP680 | 16 | 72 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G34720.1 |
| Entrez Gene | 818037 |
| iHOP | AT2G34720 |
| wikigenes | AT2G34720 |




