![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G37060.3 | ||||||||
| Common Name | NFYB8, NF-YB8, T2N18.18 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 173aa MW: 18998.3 Da PI: 6.9337 | ||||||||
| Description | nuclear factor Y, subunit B8 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 184.5 | 8.3e-58 | 28 | 125 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98
vreqdrflPian+srimk+ lPan+ki+kdake+vqecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy+eplkvyl++yre+eg++k
AT2G37060.3 28 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYMEPLKVYLMRYREMEGDTK 125
69*********************************************************************************************975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 7.9E-54 | 26 | 158 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 8.24E-41 | 31 | 149 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.4E-27 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.7E-21 | 62 | 80 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.7E-21 | 81 | 99 | No hit | No description |
| PRINTS | PR00615 | 4.7E-21 | 100 | 118 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0025195 | anatomy | pollen tube cell | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001017 | developmental stage | M germinated pollen stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 173 aa Download sequence Send to blast |
MAESQAKSPG GCGSHESGGD QSPRSLHVRE QDRFLPIANI SRIMKRGLPA NGKIAKDAKE 60 IVQECVSEFI SFVTSEASDK CQREKRKTIN GDDLLWAMAT LGFEDYMEPL KVYLMRYREM 120 EGDTKGSAKG GDPNAKKDGQ SSQNGQFSQL AHQGPYGNSQ AQQHMMVPMP GTD |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 1e-46 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 1e-46 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4g91_B | 1e-46 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-46 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.28391 | 0.0 | flower| root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 265466_at | 0.0 | ||||
| Expression Atlas | AT2G37060 | - | ||||
| AtGenExpress | AT2G37060 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G37060.3 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G54830, AT1G56170 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G37060 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY070477 | 0.0 | AY070477.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. | |||
| GenBank | AY091673 | 0.0 | AY091673.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001031500.1 | 1e-128 | nuclear factor Y, subunit B8 | ||||
| Refseq | NP_850277.2 | 1e-128 | nuclear factor Y, subunit B8 | ||||
| Refseq | NP_973617.1 | 1e-128 | nuclear factor Y, subunit B8 | ||||
| Swissprot | Q8VYK4 | 1e-129 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A178VR64 | 1e-126 | A0A178VR64_ARATH; NF-YB8 | ||||
| STRING | AT2G37060.3 | 1e-128 | (Arabidopsis thaliana) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G37060.3 |
| Entrez Gene | 818282 |
| iHOP | AT2G37060 |
| wikigenes | AT2G37060 |




