![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G40970.1 | ||||||||
| Common Name | MYBC1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 248aa MW: 27554.4 Da PI: 9.5557 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 96 | 2.9e-30 | 105 | 158 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
+prl+Wtp+LH+rFv+av +L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
AT2G40970.1 105 RPRLVWTPQLHKRFVDAVGHL-GIKNAVPKTIMQLMSVEGLTRENVASHLQKYRL 158
59*******************.********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 9.19 | 102 | 161 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.0E-19 | 102 | 162 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.8E-30 | 104 | 163 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 4.9E-24 | 106 | 158 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 6.7E-7 | 108 | 157 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009409 | Biological Process | response to cold | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0009066 | anatomy | anther | ||||
| PO:0009067 | anatomy | filament | ||||
| PO:0009073 | anatomy | stigma | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 248 aa Download sequence Send to blast |
MREDNPNWFL RWEEELPSPE ELIPISQTLI TPHLALAFQI GSPNHHLGSK RTTAIYHQKL 60 QSSTTPTTPT PTPPPMMMNS DFGGGDSTDL GSGSIGGEPA RTLKRPRLVW TPQLHKRFVD 120 AVGHLGIKNA VPKTIMQLMS VEGLTRENVA SHLQKYRLYL RRMQGGNGNG ITGGHVIVSD 180 SATDRLFASS PVPAHFLSPD YLMPPLEHSY MGKHVITQQN QVVRNLRYED SEYGHGSMKM 240 LKLFPAGN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5lxu_A | 3e-32 | 105 | 161 | 1 | 57 | Transcription factor LUX |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.27776 | 0.0 | root| silique | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 30688486 | 0.0 | ||||
| Genevisible | 267077_at | 0.0 | ||||
| Expression Atlas | AT2G40970 | - | ||||
| AtGenExpress | AT2G40970 | - | ||||
| ATTED-II | AT2G40970 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, stems, petioles, filaments, stigma, pedicels, sepals, anthers, petals, and siliques. {ECO:0000269|PubMed:20331973}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G40970.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G40970 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC002409 | 0.0 | AC002409.3 Arabidopsis thaliana chromosome 2 clone T20B5 map CIC11C08, complete sequence. | |||
| GenBank | AC004261 | 0.0 | AC004261.3 Arabidopsis thaliana chromosome 2 clone T3K9 map CIC11C08, complete sequence. | |||
| GenBank | AY072381 | 0.0 | AY072381.1 Arabidopsis thaliana unknown protein (At2g40970) mRNA, complete cds. | |||
| GenBank | BT000098 | 0.0 | BT000098.1 Arabidopsis thaliana unknown protein (At2g40970) mRNA, complete cds. | |||
| GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_181630.1 | 0.0 | Homeodomain-like superfamily protein | ||||
| Swissprot | O22210 | 0.0 | MYBC1_ARATH; Transcription factor MYBC1 | ||||
| TrEMBL | A0A178VYV1 | 0.0 | A0A178VYV1_ARATH; MYBC1 | ||||
| STRING | AT2G40970.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1549 | 27 | 91 | Representative plant | OGRP1157 | 17 | 53 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G40970.1 |
| Entrez Gene | 818697 |
| iHOP | AT2G40970 |
| wikigenes | AT2G40970 |




