![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G43280.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | FAR1 | ||||||||
| Protein Properties | Length: 206aa MW: 24019.4 Da PI: 9.2186 | ||||||||
| Description | FAR1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | FAR1 | 85 | 1.1e-26 | 37 | 125 | 2 | 90 |
FAR1 2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
fY++Y++++GF +r+ + ++s+++g+i r+f C+keg+ + + k + r++r++tr gCka+++vk +++gkw++tk+++eHnH+l+
AT2G43280.1 37 FYDDYSRRLGFVMRVMSCRRSEKDGRILARRFGCNKEGHCVSIRGKFGSVRKPRPSTREGCKAMIHVKYDRSGKWVITKFVKEHNHPLV 125
9**************************************999999989***************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03101 | 2.7E-24 | 37 | 125 | IPR004330 | FAR1 DNA binding domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009585 | Biological Process | red, far-red light phototransduction | ||||
| GO:0010018 | Biological Process | far-red light signaling pathway | ||||
| GO:0042753 | Biological Process | positive regulation of circadian rhythm | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 206 aa Download sequence Send to blast |
MEDEDDPTTK NSNNTDDFAI EPREGIIFES EDAAKMFYDD YSRRLGFVMR VMSCRRSEKD 60 GRILARRFGC NKEGHCVSIR GKFGSVRKPR PSTREGCKAM IHVKYDRSGK WVITKFVKEH 120 NHPLVVSPRE ARHTLDEKDK RIQELTIELR NKKRLCAAYK EQLDAFAKIV EEHSNQIAKK 180 VENVVNNLKE FEHLEHALLR SKQDAI |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.36909 | 0.0 | root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 257374_at | 0.0 | ||||
| Expression Atlas | AT2G43280 | - | ||||
| AtGenExpress | AT2G43280 | - | ||||
| ATTED-II | AT2G43280 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Putative transcription activator involved in regulating light control of development. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G43280.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G43280 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT002891 | 0.0 | BT002891.1 Arabidopsis thaliana clone RAFL14-97-G02 (R20421) unknown protein (At2g43280) mRNA, complete cds. | |||
| GenBank | BT004409 | 0.0 | BT004409.1 Arabidopsis thaliana clone U20421 unknown protein (At2g43280) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_181857.2 | 1e-153 | Far-red impaired responsive (FAR1) family protein | ||||
| Swissprot | Q9SZL8 | 8e-24 | FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5 | ||||
| TrEMBL | Q84J94 | 1e-151 | Q84J94_ARATH; Far-red impaired responsive (FAR1) family protein | ||||
| STRING | AT2G43280.1 | 1e-152 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3918 | 28 | 55 | Representative plant | OGRP3376 | 7 | 27 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G43280.1 |
| Entrez Gene | 818930 |
| iHOP | AT2G43280 |
| wikigenes | AT2G43280 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




