![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT2G46130.1 | ||||||||
| Common Name | ATWRKY43, T3F17.22, WRKY43 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 109aa MW: 12951.8 Da PI: 9.9919 | ||||||||
| Description | WRKY DNA-binding protein 43 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 103.8 | 9.7e-33 | 29 | 87 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ldDgy+WrKYGqK+vk+s +prsYYrCt++ C+vkk+v+r ++++++ve+tYeg Hnh+
AT2G46130.1 29 LDDGYRWRKYGQKSVKNSLYPRSYYRCTQHMCNVKKQVQRLSKETSIVETTYEGIHNHP 87
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 3.0E-33 | 14 | 87 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.44E-28 | 21 | 88 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 27.714 | 24 | 89 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.4E-37 | 29 | 88 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 3.3E-26 | 30 | 87 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 109 aa Download sequence Send to blast |
MNGLVDSSRD KKMKNPRFSF RTKSDADILD DGYRWRKYGQ KSVKNSLYPR SYYRCTQHMC 60 NVKKQVQRLS KETSIVETTY EGIHNHPCEE LMQTLTPLLH QLQFLSKFT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 7e-25 | 19 | 86 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 7e-25 | 19 | 86 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 266597_at | 1e-161 | ||||
| Expression Atlas | AT2G46130 | - | ||||
| AtGenExpress | AT2G46130 | - | ||||
| ATTED-II | AT2G46130 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | member of WRKY Transcription Factor; Group II-c | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00317 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT2G46130.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| IntAct | Search Q8GY11 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT2G46130 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK117931 | 0.0 | AK117931.1 Arabidopsis thaliana At2g46130 mRNA for putative WRKY transcription factor (WRKY43), complete cds, clone: RAFL19-12-A14. | |||
| GenBank | BT004701 | 0.0 | BT004701.1 Arabidopsis thaliana At2g46130 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_182136.2 | 2e-78 | WRKY DNA-binding protein 43 | ||||
| Swissprot | Q8GY11 | 2e-79 | WRK43_ARATH; Probable WRKY transcription factor 43 | ||||
| TrEMBL | D7LDW5 | 5e-69 | D7LDW5_ARALL; WRKY DNA-binding protein 43 | ||||
| STRING | AT2G46130.1 | 9e-78 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM509 | 28 | 154 | Representative plant | OGRP14 | 17 | 875 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT2G46130.1 |
| Entrez Gene | 819220 |
| iHOP | AT2G46130 |
| wikigenes | AT2G46130 |




