![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G01530.1 | ||||||||
| Common Name | ATMYB57, F4P13.8, MYB57 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 206aa MW: 23716.8 Da PI: 10.0597 | ||||||||
| Description | myb domain protein 57 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 50.3 | 5.5e-16 | 27 | 74 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd +l +++ +G g W+++a+ g++Rt+k+c++rw++yl
AT3G01530.1 27 KGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYL 74
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 56.9 | 4.7e-18 | 80 | 123 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
rg+ T+eE++l+++++++lG++ W++Ia++++ gRt++++k++w++
AT3G01530.1 80 RGNITEEEQLLIIQLHAKLGNR-WSKIAKHLP-GRTDNEIKNFWRT 123
7999******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.864 | 22 | 74 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.98E-29 | 25 | 121 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 9.4E-12 | 26 | 76 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.0E-14 | 27 | 74 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 9.5E-22 | 28 | 81 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 3.33E-8 | 29 | 74 | No hit | No description |
| PROSITE profile | PS51294 | 25.259 | 75 | 129 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.2E-16 | 79 | 127 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 9.5E-17 | 80 | 123 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.8E-25 | 82 | 129 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.18E-12 | 84 | 123 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
| GO:0009740 | Biological Process | gibberellic acid mediated signaling pathway | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0080086 | Biological Process | stamen filament development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0009062 | anatomy | gynoecium | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 206 aa Download sequence Send to blast |
METTMKKKGR VKATITSQKE EEGTVRKGPW TMEEDFILFN YILNHGEGLW NSVAKASGLK 60 RTGKSCRLRW LNYLRPDVRR GNITEEEQLL IIQLHAKLGN RWSKIAKHLP GRTDNEIKNF 120 WRTKIQRHMK VSSENMMNHQ HHCSGNSQSS GMTTQGSSGK AIDTAESFSQ AKTTTFNVVE 180 QQSNENYWNV EDLWPVHLLN GDHHVI |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 5e-29 | 1 | 127 | 1 | 126 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 42563407 | 0.0 | ||||
| Genevisible | 259187_at | 0.0 | ||||
| Expression Atlas | AT3G01530 | - | ||||
| AtGenExpress | AT3G01530 | - | ||||
| ATTED-II | AT3G01530 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed specifically in flowers. {ECO:0000269|PubMed:19325888}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Member of the R2R3 factor gene family. | |||||
| UniProt | Transcription factor acting redundantly with MYB21 and MYB24 to control stamen filament elongation in the late developed flowers. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:19325888}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00324 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G01530.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | Gibberellin, Jasmonic acid | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: No visible phenotype. Myb21 and myb57 double mutant has an intermediate sterility phenotype and petals that grew to a final height parallel to the pistil. Myb24 and myb57 double mutant has petals that grew to a final height parallel to the pistil. Myb21, myb24 and myb57 triple mutant has a strongly reduced fertility and an arrested growth of the petals that never grew out of the sepals. {ECO:0000269|PubMed:19325888}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G01530 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY519582 | 0.0 | AY519582.1 Arabidopsis thaliana MYB transcription factor (At3g01530) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_186802.1 | 1e-154 | myb domain protein 57 | ||||
| Swissprot | Q9SSA1 | 1e-155 | MYB57_ARATH; Transcription factor MYB57 | ||||
| TrEMBL | A0A178VG23 | 1e-152 | A0A178VG23_ARATH; MYB57 | ||||
| STRING | AT3G01530.1 | 1e-153 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G01530.1 |
| Entrez Gene | 821113 |
| iHOP | AT3G01530 |
| wikigenes | AT3G01530 |




