PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G01970.1

Common Name

ATWRKY45, F1C9.25, F28J7.30, WRKY45

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 147aa MW: 17225.4 Da PI: 9.2058

Description

WRKY DNA-binding protein 45

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G01970.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	98.9	3.1e-31	64	122	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYY+Ct +gC+vkk+v+r+ d+ vv++tY+g H+h AT3G01970.1 64 LDDGYRWRKYGQKAVKNNPFPRSYYKCTEEGCRVKKQVQRQWGDEGVVVTTYQGVHTHA 122 59********************************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	8.7E-33	49	122	IPR003657	WRKY domain
SuperFamily	SSF118290	2.22E-28	56	123	IPR003657	WRKY domain
PROSITE profile	PS50811	29.838	59	124	IPR003657	WRKY domain
SMART	SM00774	4.7E-36	64	123	IPR003657	WRKY domain
Pfam	PF03106	2.4E-25	65	121	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0006817	Biological Process	phosphate ion transport
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0008134	Molecular Function	transcription factor binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0025281	anatomy	pollen
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 147 aa Download sequence Send to blast
MEDRRCDVLF PCSSSVDPRL TEFHGVDNSA QPTTSSEEKP RSKKKKKERE ARYAFQTRSQ 60 VDILDDGYRW RKYGQKAVKN NPFPRSYYKC TEEGCRVKKQ VQRQWGDEGV VVTTYQGVHT 120 HAVDKPSDNF HHILTQMHIF PPFCLKE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-27	54	121	7	74	Probable WRKY transcription factor 4
2lex_A	2e-27	54	121	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.26598	0.0	leaf\| seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	145337998	0.0
Genevisible	258975_at	0.0
Expression Atlas	AT3G01970	-
AtGenExpress	AT3G01970	-
ATTED-II	AT3G01970	-

Functional Description ? help Back to Top
Source	Description
TAIR	member of WRKY Transcription Factor; Group I
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250\|UniProtKB:Q9SI37}.

Function -- GeneRIF ? help Back to Top
WRKY45 is involved in Arabidopsis response to phosphate starvation by direct up-regulation of PHT1;1 expression. [PMID: 24586044] that RGL1 repressed the transcription activation function of WRKY45, thereby attenuating the expression of its regulon. [PMID: 28735023]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00325	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G01970.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G01970

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF426251	0.0	AF426251.1 Arabidopsis thaliana WRKY transcription factor 45 (WRKY45) mRNA, complete cds.
GenBank	AK118457	0.0	AK118457.1 Arabidopsis thaliana At3g01970 mRNA for putative WRKY-like transcriptional regulator protein, complete cds, clone: RAFL19-70-A15.
GenBank	BT024684	0.0	BT024684.1 Arabidopsis thaliana At3g01970 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_186846.1	1e-108	WRKY DNA-binding protein 45
Swissprot	Q9S763	1e-109	WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBL	A0A384KXL3	1e-107	A0A384KXL3_ARATH; WRKY45
TrEMBL	Q29Q72	1e-107	Q29Q72_ARATH; At3g01970
STRING	AT3G01970.1	1e-108	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM509	28	154
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT3G01970.1
Entrez Gene	821270
iHOP	AT3G01970
wikigenes	AT3G01970

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Hass C, et al. The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. EMBO J., 2004. 23(16): p. 3290-302 [PMID:15282545] Contento AL,Kim SJ,Bassham DC Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation. Plant Physiol., 2004. 135(4): p. 2330-47 [PMID:15310832] Bi YM, et al. Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity. Plant J., 2005. 44(4): p. 680-92 [PMID:16262716] Nicola Large-scale analysis of mRNA translation states during sucrose starvation in arabidopsis cells identifies cell proliferation and chromatin structure as targets of translational control. Plant Physiol., 2006. 141(2): p. 663-73 [PMID:16632591] Tosti N, et al. Gene expression profiles of O3-treated Arabidopsis plants. Plant Cell Environ., 2006. 29(9): p. 1686-702 [PMID:16913859] van de Mortel JE, et al. Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens. Plant Physiol., 2006. 142(3): p. 1127-47 [PMID:16998091] Lou Y,Gou JY,Xue HW PIP5K9, an Arabidopsis phosphatidylinositol monophosphate kinase, interacts with a cytosolic invertase to negatively regulate sugar-mediated root growth. Plant Cell, 2007. 19(1): p. 163-81 [PMID:17220200] Popescu SC, et al. Differential binding of calmodulin-related proteins to their targets revealed through high-density Arabidopsis protein microarrays. Proc. Natl. Acad. Sci. U.S.A., 2007. 104(11): p. 4730-5 [PMID:17360592] Shimono M, et al. Rice WRKY45 plays a crucial role in benzothiadiazole-inducible blast resistance. Plant Cell, 2007. 19(6): p. 2064-76 [PMID:17601827] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Jiang CJ, et al. Suppression of the rice fatty-acid desaturase gene OsSSI2 enhances resistance to blast and leaf blight diseases in rice. Mol. Plant Microbe Interact., 2009. 22(7): p. 820-9 [PMID:19522564] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Matsushita A, et al. Nuclear ubiquitin proteasome degradation affects WRKY45 function in the rice defense program. Plant J., 2013. 73(2): p. 302-13 [PMID:23013464] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Wang H, et al. Arabidopsis WRKY45 transcription factor activates PHOSPHATE TRANSPORTER1;1 expression in response to phosphate starvation. Plant Physiol., 2014. 164(4): p. 2020-9 [PMID:24586044] Axelos M, et al. The gene family encoding the Arabidopsis thaliana translation elongation factor EF-1 alpha: molecular cloning, characterization and expression. Mol. Gen. Genet., 1989. 219(1-2): p. 106-12 [PMID:2615757] Chen L,Xiang S,Chen Y,Li D,Yu D Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence. Mol Plant, 2017. 10(9): p. 1174-1189 [PMID:28735023]