![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G10490.1 | ||||||||
| Common Name | ANAC051, ANAC052, NAC052 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 238aa MW: 26948.5 Da PI: 7.7394 | ||||||||
| Description | NAC domain containing protein 52 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 167.9 | 3.4e-52 | 27 | 154 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96
l+pGfrFhPtdeelv++yLk+kv g+++++ ++i evdiyk+ePwdL +++k++++ewyf+s dkky +g r nrat++gyWkatgkd+e+ + +
AT3G10490.1 27 LAPGFRFHPTDEELVSYYLKRKVLGQPVRF-DAIGEVDIYKHEPWDLAvfSRLKTRDQEWYFYSALDKKYGNGARMNRATNRGYWKATGKDREIRR-D 122
579************************999.99**************8544899999*************************************99.9 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128
l g+kktLvf++grap+g +t+Wvmheyrl
AT3G10490.1 123 ILLLGMKKTLVFHSGRAPDGLRTNWVMHEYRL 154
999***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 6.15E-60 | 23 | 179 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 56.884 | 27 | 178 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.0E-27 | 29 | 154 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006351 | Biological Process | transcription, DNA-templated | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009555 | Biological Process | pollen development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0005730 | Cellular Component | nucleolus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000293 | anatomy | guard cell | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 238 aa Download sequence Send to blast |
MGRESVAVVT APPSATAPGT ASVATSLAPG FRFHPTDEEL VSYYLKRKVL GQPVRFDAIG 60 EVDIYKHEPW DLAVFSRLKT RDQEWYFYSA LDKKYGNGAR MNRATNRGYW KATGKDREIR 120 RDILLLGMKK TLVFHSGRAP DGLRTNWVMH EYRLVEYETE KNGNLVQDAY VLCRVFHKNN 180 IGPPSGNRYA PFMEEEWADD EGALIPGIDV KLRLEPPPVA NGNDQMDQII YASSGVHL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-48 | 26 | 180 | 16 | 167 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-48 | 26 | 180 | 16 | 167 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-48 | 26 | 180 | 16 | 167 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-48 | 26 | 180 | 16 | 167 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swm_B | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swm_C | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swm_D | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swp_A | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swp_B | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swp_C | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 3swp_D | 4e-48 | 26 | 180 | 19 | 170 | NAC domain-containing protein 19 |
| 4dul_A | 4e-48 | 26 | 180 | 16 | 167 | NAC domain-containing protein 19 |
| 4dul_B | 4e-48 | 26 | 180 | 16 | 167 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.20993 | 0.0 | flower| root| seed| silique | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 258926_s_at | 0.0 | ||||
| Expression Atlas | AT3G10490 | - | ||||
| AtGenExpress | AT3G10490 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in floral organs, and, at low levels, in other organs. {ECO:0000269|PubMed:25578968}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00612 | ChIP-seq | SRX669382 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G10490.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G10490 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY059764 | 0.0 | AY059764.1 Arabidopsis thaliana At3g10490 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_566375.1 | 1e-179 | NAC domain containing protein 52 | ||||
| Swissprot | Q9SQY0 | 1e-175 | NAC52_ARATH; NAC domain containing protein 52 | ||||
| TrEMBL | A0A178VCW1 | 1e-172 | A0A178VCW1_ARATH; NAC052 | ||||
| STRING | AT3G10490.2 | 1e-173 | (Arabidopsis thaliana) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G10490.1 |
| Entrez Gene | 820213 |
| iHOP | AT3G10490 |
| wikigenes | AT3G10490 |




