![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G11090.1 | ||||||||
| Common Name | ASL12, F11B9.5, F9F8.10, LBD21 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 165aa MW: 18159.8 Da PI: 6.501 | ||||||||
| Description | LOB domain-containing protein 21 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 123.8 | 8.7e-39 | 11 | 110 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
+CaaCk+l+r+C++ C++apyf +++ +fa vhk+FGasnv+kll ++pee+r+++++sl+yeAe+r++dPvyG++g i +lq+++ +l+++la+++
AT3G11090.1 11 SCAACKLLKRRCTPTCIFAPYFRSSDLITFAKVHKVFGASNVSKLLGEVPEEQRQETVNSLAYEAEVRLKDPVYGCIGAIASLQKKMLELQHDLAVAR 108
6*********************************************************************************************9998 PP
DUF260 99 ee 100
++
AT3G11090.1 109 TR 110
75 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.679 | 10 | 111 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 6.5E-38 | 11 | 108 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008150 | Biological Process | biological_process | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 165 aa Download sequence Send to blast |
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP YFRSSDLITF AKVHKVFGAS NVSKLLGEVP 60 EEQRQETVNS LAYEAEVRLK DPVYGCIGAI ASLQKKMLEL QHDLAVARTR LLAHSGVNNS 120 QVSPLDDSPE LAAFLDLVPY SDLMLLDGST NLDAYLYDLG QPPFV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 9e-42 | 6 | 115 | 6 | 115 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 9e-42 | 6 | 115 | 6 | 115 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 240255324 | 0.0 | ||||
| Genevisible | 256427_at | 0.0 | ||||
| Expression Atlas | AT3G11090 | - | ||||
| AtGenExpress | AT3G11090 | - | ||||
| ATTED-II | AT3G11090 | - | ||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G11090.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G11090 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB473845 | 0.0 | AB473845.1 Arabidopsis thaliana ASL12 mRNA for ASYMMETRIC LEAVES2-like 12 protein, complete cds. | |||
| GenBank | AC073395 | 0.0 | AC073395.6 Arabidopsis thaliana chromosome 3 BAC F11B9 genomic sequence, complete sequence. | |||
| GenBank | ATAC009991 | 0.0 | AC009991.5 Arabidopsis thaliana chromosome III BAC F9F8 genomic sequence, complete sequence. | |||
| GenBank | CP002686 | 0.0 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_187720.1 | 1e-119 | LOB domain-containing protein 21 | ||||
| Swissprot | Q9SRL8 | 1e-120 | LBD21_ARATH; LOB domain-containing protein 21 | ||||
| TrEMBL | A0A178V6L2 | 1e-118 | A0A178V6L2_ARATH; LBD21 | ||||
| STRING | AT3G11090.1 | 1e-119 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM10255 | 27 | 35 | Representative plant | OGRP60 | 16 | 318 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G11090.1 |
| Entrez Gene | 820280 |
| iHOP | AT3G11090 |
| wikigenes | AT3G11090 |




