![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G21270.1 | ||||||||
| Common Name | ADOF2, DOF2, DOF3.1, MXL8.14 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 204aa MW: 22530 Da PI: 9.5985 | ||||||||
| Description | DOF zinc finger protein 2 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 126.3 | 9.2e-40 | 25 | 84 | 2 | 61 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn ++
AT3G21270.1 25 EQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGSRKNATK 84
5789****************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF02701 | 1.9E-33 | 27 | 83 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.255 | 29 | 83 | IPR003851 | Zinc finger, Dof-type |
| ProDom | PD007478 | 3.0E-23 | 29 | 77 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 31 | 67 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000084 | anatomy | plant sperm cell | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025195 | anatomy | pollen tube cell | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 204 aa Download sequence Send to blast |
MQDPAAYYQT MMAKQQQQQQ PQFAEQEQLK CPRCDSPNTK FCYYNNYNLS QPRHFCKSCR 60 RYWTKGGALR NVPVGGGSRK NATKRSTSSS SSASSPSNSS QNKKTKNPDP DPDPRNSQKP 120 DLDPTRMLYG FPIGDQDVKG MEIGGSFSSL LANNMQLGLG GGGIMLDGSG WDHPGMGLGL 180 RRTEPGNNNN NPWTDLAMNR AEKN |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.257 | 0.0 | flower| inflorescence | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 258044_at | 0.0 | ||||
| Expression Atlas | AT3G21270 | - | ||||
| AtGenExpress | AT3G21270 | - | ||||
| ATTED-II | AT3G21270 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes Dof zinc finger protein adof2. | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G21270.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G21270 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB017565 | 0.0 | AB017565.1 Arabidopsis thaliana adof2 mRNA for Dof zinc finger protein, complete cds. | |||
| GenBank | AB023045 | 0.0 | AB023045.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MXL8. | |||
| GenBank | AY150391 | 0.0 | AY150391.1 Arabidopsis thaliana Dof zinc finger protein (At3g21270) mRNA, complete cds. | |||
| GenBank | CP002686 | 0.0 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_188764.1 | 1e-151 | DOF zinc finger protein 2 | ||||
| Swissprot | Q94AR6 | 1e-152 | DOF31_ARATH; Dof zinc finger protein DOF3.1 | ||||
| TrEMBL | A0A178VA07 | 1e-149 | A0A178VA07_ARATH; DOF2 | ||||
| STRING | AT3G21270.1 | 1e-150 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM1269 | 28 | 96 | Representative plant | OGRP38 | 17 | 445 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G21270.1 |
| Entrez Gene | 821681 |
| iHOP | AT3G21270 |
| wikigenes | AT3G21270 |




