![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G24120.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 298aa MW: 32553.7 Da PI: 7.1803 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 107.5 | 7e-34 | 41 | 95 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
AT3G24120.2 41 KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 95
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.646 | 38 | 98 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.8E-32 | 38 | 96 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 6.09E-17 | 40 | 96 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 6.1E-24 | 41 | 96 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 6.1E-8 | 43 | 93 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 4.6E-24 | 139 | 188 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010628 | Biological Process | positive regulation of gene expression | ||||
| GO:0016036 | Biological Process | cellular response to phosphate starvation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000037 | anatomy | shoot apex | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0008019 | anatomy | leaf lamina base | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009009 | anatomy | plant embryo | ||||
| PO:0009010 | anatomy | seed | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009052 | anatomy | flower pedicel | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020038 | anatomy | petiole | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0020137 | anatomy | leaf apex | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0025195 | anatomy | pollen tube cell | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0001016 | developmental stage | L mature pollen stage | ||||
| PO:0001017 | developmental stage | M germinated pollen stage | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
| PO:0001081 | developmental stage | mature plant embryo stage | ||||
| PO:0001185 | developmental stage | plant embryo globular stage | ||||
| PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 298 aa Download sequence Send to blast |
MYSAIRSLPL DGGHVGGDYH GPLDGTNLPG DACLVLTTDP KPRLRWTTEL HERFVDAVTQ 60 LGGPDKATPK TIMRTMGVKG LTLYHLKSHL QKFRLGRQAG KESTENSKDA SCVGESQDTG 120 SSSTSSMRMA QQEQNEGYQV TEALRAQMEV QRRLHDQLEY GQVQRRLQLR IEAQGKYLQS 180 ILEKACKAFD EQAATFAGLE AAREELSELA IKVSNSSQGT SVPYFDATKM MMMPSLSELA 240 VAIDNKNNIT TNCSVESSLT SITHGSSISA ASMKKRQRGD NLGVGYESGW IMPSSTIG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4r_A | 6e-19 | 41 | 97 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 6e-19 | 41 | 97 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 6e-19 | 41 | 97 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 6e-19 | 41 | 97 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.26588 | 0.0 | flower| silique | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 257250_at | 0.0 | ||||
| Expression Atlas | AT3G24120 | - | ||||
| AtGenExpress | AT3G24120 | - | ||||
| ATTED-II | AT3G24120 | - | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00378 | DAP | 27203113 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G24120.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT4G13640 | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G24120 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY050355 | 0.0 | AY050355.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds. | |||
| GenBank | AY088428 | 0.0 | AY088428.1 Arabidopsis thaliana clone 6626 mRNA, complete sequence. | |||
| GenBank | AY094046 | 0.0 | AY094046.1 Arabidopsis thaliana AT3g24120/MUJ8_3 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_974356.1 | 0.0 | Homeodomain-like superfamily protein | ||||
| Swissprot | Q94A57 | 0.0 | PHL2_ARATH; Protein PHR1-LIKE 2 | ||||
| TrEMBL | A0A178VFD1 | 0.0 | A0A178VFD1_ARATH; Uncharacterized protein | ||||
| STRING | AT3G24120.2 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM3515 | 25 | 61 | Representative plant | OGRP78 | 17 | 262 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G24120.2 |
| Entrez Gene | 821998 |
| iHOP | AT3G24120 |
| wikigenes | AT3G24120 |




