PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G27650.1

Common Name

ASL3, LBD25, MGF10.6

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

LBD

Protein Properties

Length: 159aa MW: 17749.4 Da PI: 9.0107

Description

LOB domain-containing protein 25

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G27650.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	140.7	4.8e-44	39	137	1	99
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+ el++++ AT3G27650.1 39 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILHEVAPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVLRLQRELEETN 136 7*********************************************************************************************9987 PP DUF260 99 e 99 + AT3G27650.1 137 A 137 6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	27.314	38	139	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.4E-43	39	136	IPR004883	Lateral organ boundaries, LOB

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0008150	Biological Process	biological_process

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009046	anatomy	flower
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MPKRETKKIK PSQEVIKEGP FLVAIHLKGI YMSNYTNSPC AACKFLRRKC TSDCVFAPYF 60 PPEEPTKFAN VHRIFGASNV SKILHEVAPH QREDAVNSLA YEAEARLKDP VYGCVGAISV 120 LQRQVLRLQR ELEETNADLM RYAGCLGGET TSAYGGRRG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	2e-60	37	152	9	125	LOB family transfactor Ramosa2.1
5ly0_B	2e-60	37	152	9	125	LOB family transfactor Ramosa2.1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.27202	0.0	leaf

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	18405471	0.0
Genevisible	258241_at	0.0
Expression Atlas	AT3G27650	-
AtGenExpress	AT3G27650	-
ATTED-II	AT3G27650	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269\|PubMed:12068116}.

Function -- GeneRIF ? help Back to Top
DDA1 (LBD25) functions in both the auxin signalling and photomorphogenesis pathways. [PMID: 20797997]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G27650.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G27650

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB164304	0.0	AB164304.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like gene 3 protein, partial cds.
GenBank	AB473836	0.0	AB473836.1 Arabidopsis thaliana ASL3 mRNA for ASYMMETRIC LEAVES2-like 3 protein, complete cds.
GenBank	AF447892	0.0	AF447892.1 Arabidopsis thaliana LOB DOMAIN 25 (LBD25) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_566823.1	1e-116	LOB domain-containing protein 25
Swissprot	Q8L8Q3	1e-118	LBD25_ARATH; LOB domain-containing protein 25
TrEMBL	A0A178VKF4	1e-115	A0A178VKF4_ARATH; LBD25
STRING	AT3G27650.1	1e-116	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM131	28	340
Representative plant	OGRP60	16	318

Link Out ? help Back to Top
Phytozome	AT3G27650.1
Entrez Gene	822387
iHOP	AT3G27650
wikigenes	AT3G27650

Publications ? help Back to Top
Iwakawa H, et al. The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper. Plant Cell Physiol., 2002. 43(5): p. 467-78 [PMID:12040093] Shuai B,Reynaga-Peña CG,Springer PS The lateral organ boundaries gene defines a novel, plant-specific gene family. Plant Physiol., 2002. 129(2): p. 747-61 [PMID:12068116] De Paepe A,Vuylsteke M,Van Hummelen P,Zabeau M,Van Der Straeten D Transcriptional profiling by cDNA-AFLP and microarray analysis reveals novel insights into the early response to ethylene in Arabidopsis. Plant J., 2004. 39(4): p. 537-59 [PMID:15272873] Stracke R, et al. Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling. Plant J., 2007. 50(4): p. 660-77 [PMID:17419845] Matsumura Y,Iwakawa H,Machida Y,Machida C Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members. Plant J., 2009. 58(3): p. 525-37 [PMID:19154202] Mangeon A,Bell EM,Lin WC,Jablonska B,Springer PS Misregulation of the LOB domain gene DDA1 suggests possible functions in auxin signalling and photomorphogenesis. J. Exp. Bot., 2011. 62(1): p. 221-33 [PMID:20797997] Kim M,Kim MJ,Pandey S,Kim J Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development. Plant Cell Physiol., 2016. 57(11): p. 2291-2299 [PMID:27519310]