![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G28917.1 | ||||||||
| Common Name | MIF2, MLD15.10 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 100aa MW: 10793.1 Da PI: 8.2928 | ||||||||
| Description | mini zinc finger 2 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 107.9 | 5.8e-34 | 30 | 87 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+aal+CaACgCHR+FHRre e+e
AT3G28917.1 30 TVRYGECQKNHAAAVGGYAVDGCREFMASRGEEGTVAALTCAACGCHRSFHRREIETE 87
79****************************************************9876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 6.0E-34 | 1 | 97 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 2.3E-29 | 31 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 4.0E-28 | 32 | 84 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 24.642 | 33 | 83 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0005515 | Molecular Function | protein binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0009001 | anatomy | fruit | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0009049 | anatomy | inflorescence | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 100 aa Download sequence Send to blast |
MRKRQVVLRR ASPEEPSRSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMASRG 60 EEGTVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.47938 | 1e-152 | flower| leaf | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| Expression Atlas | AT3G28917 | |||||
| AtGenExpress | AT3G28917 | |||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269|PubMed:16412086}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G28917.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G28917 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK221094 | 1e-169 | AK221094.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL22-84-D24. | |||
| GenBank | AP000386 | 1e-169 | AP000386.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone:MLD15. | |||
| GenBank | BT024663 | 1e-169 | BT024663.1 Arabidopsis thaliana unknown protein (At3g28917) mRNA, complete cds. | |||
| GenBank | CP002686 | 1e-169 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_974373.1 | 1e-67 | mini zinc finger 2 | ||||
| Refseq | XP_006292529.1 | 1e-67 | mini zinc finger protein 2 | ||||
| Swissprot | Q9LJW5 | 9e-69 | MIF2_ARATH; Mini zinc finger protein 2 | ||||
| TrEMBL | R0FRW7 | 2e-66 | R0FRW7_9BRAS; Uncharacterized protein | ||||
| STRING | Cagra.0498s0002.1.p | 4e-67 | (Capsella grandiflora) | ||||
| STRING | AT3G28917.1 | 4e-67 | (Arabidopsis thaliana) | ||||
| STRING | XP_006292529.1 | 4e-67 | (Capsella rubella) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM944 | 28 | 114 | Representative plant | OGRP91 | 16 | 237 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G28917.1 |
| Entrez Gene | 2745896 |
| iHOP | AT3G28917 |
| wikigenes | AT3G28917 |




