![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G29035.1 | ||||||||
| Common Name | ANAC059, ATNAC3, MRI12.1, NAC3, NAC59, ORS1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 318aa MW: 35825.6 Da PI: 8.4219 | ||||||||
| Description | NAC domain containing protein 3 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 180.8 | 3.6e-56 | 24 | 150 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98
lppGfrFhPtdeel+++yL++kv ++ +++ +i evd++kvePwdLp k+k +ekewyfF+ rd+ky+tg r+nratk+gyWkatgkdke+++ +++
AT3G29035.1 24 LPPGFRFHPTDEELITHYLRPKVVNSFFSA-IAIGEVDLNKVEPWDLPWKAKLGEKEWYFFCVRDRKYPTGLRTNRATKAGYWKATGKDKEIFK-GKS 119
79*************************999.88***************888999****************************************.999 PP
NAM 99 lvglkktLvfykgrapkgektdWvmheyrle 129
lvg+kktLvfykgrapkg+kt+Wvmheyrle
AT3G29035.1 120 LVGMKKTLVFYKGRAPKGVKTNWVMHEYRLE 150
*****************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.83E-61 | 21 | 174 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 57.028 | 24 | 174 | IPR003441 | NAC domain |
| Pfam | PF02365 | 3.3E-30 | 25 | 149 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009611 | Biological Process | response to wounding | ||||
| GO:0042542 | Biological Process | response to hydrogen peroxide | ||||
| GO:0051091 | Biological Process | positive regulation of sequence-specific DNA binding transcription factor activity | ||||
| GO:1900057 | Biological Process | positive regulation of leaf senescence | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000258 | anatomy | root cortex | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0003015 | anatomy | primary root differentiation zone | ||||
| PO:0005679 | anatomy | epidermis | ||||
| PO:0006502 | anatomy | floral organ abscission zone | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009029 | anatomy | stamen | ||||
| PO:0009030 | anatomy | carpel | ||||
| PO:0009031 | anatomy | sepal | ||||
| PO:0009032 | anatomy | petal | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0025034 | anatomy | leaf | ||||
| PO:0025257 | anatomy | primary root elongation zone | ||||
| PO:0025281 | anatomy | pollen | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007616 | developmental stage | flowering stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 318 aa Download sequence Send to blast |
MDYKVSRSGE IVEGEVEDSE KIDLPPGFRF HPTDEELITH YLRPKVVNSF FSAIAIGEVD 60 LNKVEPWDLP WKAKLGEKEW YFFCVRDRKY PTGLRTNRAT KAGYWKATGK DKEIFKGKSL 120 VGMKKTLVFY KGRAPKGVKT NWVMHEYRLE GKFAIDNLSK TAKNECVISR VFHTRTDGTK 180 EHMSVGLPPL MDSSPYLKSR GQDSLAGTTL GGLLSHVTYF SDQTTDDKSL VADFKTTMFG 240 SGSTNFLPNI GSLLDFDPLF LQNNSSVLKM LLDNEETQFK KNLHNSGSSE SELTASSWQG 300 HNSYGSTGPV NLDCVWKF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 2e-50 | 15 | 180 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 2e-50 | 15 | 180 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 2e-50 | 15 | 180 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 2e-50 | 15 | 180 | 8 | 171 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swm_B | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swm_C | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swm_D | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swp_A | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swp_B | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swp_C | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 3swp_D | 2e-50 | 15 | 180 | 11 | 174 | NAC domain-containing protein 19 |
| 4dul_A | 2e-50 | 15 | 180 | 8 | 171 | NAC domain-containing protein 19 |
| 4dul_B | 2e-50 | 15 | 180 | 8 | 171 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.27282 | 0.0 | root | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| GEO | 145339050 | 0.0 | ||||
| Genevisible | 258059_at | 0.0 | ||||
| Expression Atlas | AT3G29035 | - | ||||
| AtGenExpress | AT3G29035 | - | ||||
| ATTED-II | AT3G29035 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Age-dependent accumulation. First observed in young seedlings in cotyledons and regularly in the tip regions of very young leaves. Accumulates strongly in older leaf parts at the senescence onset. In flowers, present in mature organs such as old sepals, petals, old stamens, mature anthers, and pollen grains. Confined to floral organ abscission zone of mature flowers. Also observed in roots. {ECO:0000269|PubMed:21303842}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in root cortex, phloem, atrichoblast and quiescent center (QC), and, to a lower extent, in root endodermis, xylem, pericycle, columella and lateral root cap (LRC) (PubMed:16581911). Expressed in roots, cotyledons, very young leaves, senescing leaves, mature flowers and pollen (PubMed:21303842). {ECO:0000269|PubMed:16581911, ECO:0000269|PubMed:21303842}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a protein with transcription factor activity. Note: this protein (AT3G29035) on occasion has also been referred to as AtNAC3, not to be confused with the AtNAC3 found at locus AT3G15500. | |||||
| UniProt | Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[AG]CGT[AG](4-5n)[AG][CT]ACGCAA-3' (PubMed:16359384, PubMed:21303842). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:21303842). {ECO:0000269|PubMed:16359384, ECO:0000269|PubMed:21303842}. | |||||
| Function -- GeneRIF ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
|
||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G29035.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Rapidly and strongly induced by H(2)O(2) treatment in both leaves and roots. Accumulates during senescence and in response to wounding. {ECO:0000269|PubMed:21303842}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Interaction ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Intact With | |||||
| BioGRID | AT5G13180, AT1G14920 | |||||
| IntAct | Search Q9LJW3 | |||||
| Phenotype -- Disruption Phenotype ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DISRUPTION PHENOTYPE: Delayed senescence accompanied by a small delay in flowering time. {ECO:0000269|PubMed:21303842}. | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G29035 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY062638 | 0.0 | AY062638.1 Arabidopsis thaliana Unknown protein (MRI12.1) mRNA, complete cds. | |||
| GenBank | BT008716 | 0.0 | BT008716.1 Arabidopsis thaliana At3g29035 gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_189546.1 | 0.0 | NAC domain containing protein 3 | ||||
| Swissprot | Q9LJW3 | 0.0 | NAC59_ARATH; NAC domain-containing protein 59 | ||||
| TrEMBL | D7LM77 | 0.0 | D7LM77_ARALL; ANAC059/ATNAC3 | ||||
| STRING | AT3G29035.1 | 0.0 | (Arabidopsis thaliana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM400 | 28 | 174 | Representative plant | OGRP17 | 15 | 800 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G29035.1 |
| Entrez Gene | 822547 |
| iHOP | AT3G29035 |
| wikigenes | AT3G29035 |




