![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | AT3G46130.4 | ||||||||
| Common Name | ATMYB48, ATMYB48-1, ATMYB48-2, ATMYB48-3, MYB48 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 236aa MW: 27163.3 Da PI: 10.0129 | ||||||||
| Description | myb domain protein 48 | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 56.4 | 7.1e-18 | 42 | 87 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
AT3G46130.4 42 RGKMTPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 87
89********************.*********.************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50090 | 4.716 | 1 | 36 | IPR017877 | Myb-like domain |
| SuperFamily | SSF46689 | 1.75E-22 | 22 | 92 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 6.8E-10 | 22 | 48 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 27.814 | 37 | 91 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.2E-17 | 41 | 89 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.5E-16 | 42 | 86 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.80E-12 | 44 | 87 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 6.9E-21 | 49 | 88 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
| GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Plant Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PO Term | PO Category | PO Description | ||||
| PO:0000013 | anatomy | cauline leaf | ||||
| PO:0000230 | anatomy | inflorescence meristem | ||||
| PO:0000293 | anatomy | guard cell | ||||
| PO:0009005 | anatomy | root | ||||
| PO:0009006 | anatomy | shoot system | ||||
| PO:0009025 | anatomy | vascular leaf | ||||
| PO:0009046 | anatomy | flower | ||||
| PO:0009047 | anatomy | stem | ||||
| PO:0020030 | anatomy | cotyledon | ||||
| PO:0020100 | anatomy | hypocotyl | ||||
| PO:0025022 | anatomy | collective leaf structure | ||||
| PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
| PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
| PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
| PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
| PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
| PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
| PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 236 aa Download sequence Send to blast |
MGFYSKSIRF EGGGRKIRIG LNRTGKSCRL RWVNYLHPGL KRGKMTPQEE RLVLELHAKW 60 GNRWSKIARK LPGRTDNEIK NYWRTHMRKK AQEKKRPVSP TSSFSNCSSS SVTTTTTNTQ 120 DTSCHSRKSS GEVSFYDTGG SRSTREMNQE NEDVYSLDDI WREIDHSAVN IIKPVKDIYS 180 EQSHCLSYPN LASPSWESSL DSIWNMDADK SKISSYFAND QFPFCFQHSR SPWSSG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 3e-18 | 23 | 91 | 37 | 105 | MYB PROTO-ONCOGENE PROTEIN |
| 1h88_C | 1e-17 | 23 | 91 | 91 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h89_C | 1e-17 | 23 | 91 | 91 | 159 | MYB PROTO-ONCOGENE PROTEIN |
| 1h8a_C | 6e-18 | 23 | 91 | 60 | 128 | MYB TRANSFORMING PROTEIN |
| 1mse_C | 3e-18 | 23 | 91 | 37 | 105 | C-Myb DNA-Binding Domain |
| 1msf_C | 3e-18 | 23 | 91 | 37 | 105 | C-Myb DNA-Binding Domain |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| At.1475 | 0.0 | leaf | ||||
| Expression -- Microarray ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | E-value | ||||
| Genevisible | 252534_at | 0.0 | ||||
| Expression Atlas | AT3G46130 | - | ||||
| AtGenExpress | AT3G46130 | - | ||||
| ATTED-II | AT3G46130 | - | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| TAIR | Encodes a putative transcription factor (MYB48) that functions to regulate flavonol biosynthesis primarily in cotyledons. | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | AT3G46130.4 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Regulation -- Hormone ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hormone | |||||
| AHD | abscisic acid, ethylene, gibberellin, jasmonic acid, salicylic acid | |||||
| Phenotype -- Mutation ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | ID | |||||
| T-DNA Express | AT3G46130 | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK176475 | 0.0 | AK176475.1 Arabidopsis thaliana mRNA for Myb DNA binding protein -like, complete cds, clone: RAFL24-27-H12. | |||
| GenBank | DQ075255 | 0.0 | DQ075255.1 Arabidopsis thaliana MYB transcription factor MYB48-1 (At3g46130) mRNA, complete cds, alternatively spliced. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001190018.1 | 1e-177 | myb domain protein 48 | ||||
| Swissprot | Q9LX82 | 1e-162 | MYB48_ARATH; Transcription factor MYB48 | ||||
| TrEMBL | F4J7Y0 | 1e-176 | F4J7Y0_ARATH; Myb domain protein 48 | ||||
| STRING | AT3G46130.1 | 1e-160 | (Arabidopsis thaliana) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | AT3G46130.4 |
| Entrez Gene | 823756 |
| iHOP | AT3G46130 |
| wikigenes | AT3G46130 |




