| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | NAM | 159.6 | 1.2e-49 | 13 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96
lp+G+rF+Ptdeel+ +yL++k++g++ ++ ++i+e+di+k+ePwdLp + +k++++ew +F++ d+ky++g+r+nrat +gyWkatgkd++++s k
AT3G49530.1 13 LPVGLRFRPTDEELIRYYLRRKINGHDDDV-KAIREIDICKWEPWDLPdfSVIKTKDSEWLYFCPLDRKYPSGSRQNRATVAGYWKATGKDRKIKSGK 109
799************************999.89***************6448889999**************************************99 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128
++ +g+k+tLvf+ grap+g++t+W++heyr+
AT3G49530.1 110 TNIIGVKRTLVFHAGRAPRGTRTNWIIHEYRA 141
99****************************96 PP
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1ut4_A | 5e-45 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 5e-45 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 5e-45 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 5e-45 | 3 | 165 | 7 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 5e-45 | 3 | 165 | 10 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 5e-45 | 3 | 165 | 7 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 5e-45 | 3 | 165 | 7 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase |
| Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Ooka H, et al.
Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] - Ko JH,Han KH,Park S,Yang J
Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Millenaar FF, et al.
How to decide? Different methods of calculating gene expression from short oligonucleotide array data will give different results. BMC Bioinformatics, 2006. 7: p. 137 [PMID:16539732] - Nakano T, et al.
Identification of genes of the plant-specific transcription-factor families cooperatively regulated by ethylene and jasmonate in Arabidopsis thaliana. J. Plant Res., 2006. 119(4): p. 407-13 [PMID:16820983] - Kim SY, et al.
Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation. Nucleic Acids Res., 2007. 35(1): p. 203-13 [PMID:17158162] - Ma S,Bohnert HJ
Integration of Arabidopsis thaliana stress-related transcript profiles, promoter structures, and cell-specific expression. Genome Biol., 2007. 8(4): p. R49 [PMID:17408486] - Kim SG,Kim SY,Park CM
A membrane-associated NAC transcription factor regulates salt-responsive flowering via FLOWERING LOCUS T in Arabidopsis. Planta, 2007. 226(3): p. 647-54 [PMID:17410378] - Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] - Chawade A,Br
Putative cold acclimation pathways in Arabidopsis thaliana identified by a combined analysis of mRNA co-expression patterns, promoter motifs and transcription factors. BMC Genomics, 2007. 8: p. 304 [PMID:17764576] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Seo PJ, et al.
Cold activation of a plasma membrane-tethered NAC transcription factor induces a pathogen resistance response in Arabidopsis. Plant J., 2010. 61(4): p. 661-71 [PMID:19947982] - Abdeen A,Schnell J,Miki B
Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3. BMC Genomics, 2010. 11: p. 69 [PMID:20105335] - Seo PJ,Park CM
A membrane-bound NAC transcription factor as an integrator of biotic and abiotic stress signals. Plant Signal Behav, 2010. 5(5): p. 481-3 [PMID:20139739] - Seo PJ, et al.
Proteolytic processing of an Arabidopsis membrane-bound NAC transcription factor is triggered by cold-induced changes in membrane fluidity. Biochem. J., 2010. 427(3): p. 359-67 [PMID:20156199] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Kim MJ, et al.
Controlled nuclear import of the transcription factor NTL6 reveals a cytoplasmic role of SnRK2.8 in the drought-stress response. Biochem. J., 2012. 448(3): p. 353-63 [PMID:22967043] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Yang ZT, et al.
A plasma membrane-tethered transcription factor, NAC062/ANAC062/NTL6, mediates the unfolded protein response in Arabidopsis. Plant J., 2014. 79(6): p. 1033-43 [PMID:24961665] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178]
|