PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G49760.1

Common Name

AtbZIP5, bZIP5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

bZIP

Protein Properties

Length: 156aa MW: 18360.1 Da PI: 9.987

Description

basic leucine-zipper 5

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G49760.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	34.5	4.3e-11	72	130	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +rk +NRe+A+rsR++K++ +ee +L+ +N++Lk++l ++++ k+e+ AT3G49760.1 72 RKKKRKLSNRESAKRSREKKQKHLEEMSIQLNQLKIQNQELKNQLRYVLYHCQRTKMEN 130 6899****************************************999999999999887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	1.2E-10	63	125	No hit	No description
SMART	SM00338	1.9E-12	68	132	IPR004827	Basic-leucine zipper domain
Pfam	PF07716	1.8E-8	69	116	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.645	70	133	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.94E-9	72	120	No hit	No description
CDD	cd14702	5.20E-17	73	124	No hit	No description
PROSITE pattern	PS00036	0	75	90	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0003015	anatomy	primary root differentiation zone
PO:0006203	anatomy	pericycle
PO:0009005	anatomy	root
PO:0020124	anatomy	root stele
PO:0025257	anatomy	primary root elongation zone

Sequence ? help Back to Top
Protein Sequence Length: 156 aa Download sequence Send to blast
MMSTISPVFS TEPGLLTSVL PAFETSFTPW DISHLFSVFD SLIDPKPVST HDYGSVNQIG 60 SDMSPTDNTD ERKKKRKLSN RESAKRSREK KQKHLEEMSI QLNQLKIQNQ ELKNQLRYVL 120 YHCQRTKMEN DRLLMEHRIL HDKLLNIRQV LMFRQT

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	70	77	ERKKKRKL
2	71	92	RKKKRKLSNRESAKRSREKKQK
3	72	77	KKKRKL

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	110742132	0.0
Genevisible	252232_at	0.0
Expression Atlas	AT3G49760	-
AtGenExpress	AT3G49760	-
ATTED-II	AT3G49760	-

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G49760.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G49760

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK226923	0.0	AK226923.1 Arabidopsis thaliana mRNA for bZIP transcription factor AtbZip5, complete cds, clone: RAFL09-21-L10.
GenBank	AL132965	0.0	AL132965.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T16K5.
GenBank	BT024823	0.0	BT024823.1 Arabidopsis thaliana At3g49760 gene, complete cds.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_566925.1	1e-113	basic leucine-zipper 5
TrEMBL	A0A384KCL6	1e-112	A0A384KCL6_ARATH; BZIP5
TrEMBL	Q29PT3	1e-112	Q29PT3_ARATH; At3g49760
STRING	AT3G49760.1	1e-112	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3338	26	65
Representative plant	OGRP8744	8	15

Link Out ? help Back to Top
Phytozome	AT3G49760.1
Entrez Gene	824138
iHOP	AT3G49760
wikigenes	AT3G49760

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Jakoby M, et al. bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis. Plant Cell Physiol., 2004. 45(3): p. 309-17 [PMID:15047879] Deppmann CD, et al. Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] Lee JY, et al. Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60 [PMID:16581911] Ehlert A, et al. Two-hybrid protein-protein interaction analysis in Arabidopsis protoplasts: establishment of a heterodimerization map of group C and group S bZIP transcription factors. Plant J., 2006. 46(5): p. 890-900 [PMID:16709202] Deppmann CD,Alvania RS,Taparowsky EJ Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] Diet A, et al. The Arabidopsis root hair cell wall formation mutant lrx1 is suppressed by mutations in the RHM1 gene encoding a UDP-L-rhamnose synthase. Plant Cell, 2006. 18(7): p. 1630-41 [PMID:16766693] Dinneny JR, et al. Cell identity mediates the response of Arabidopsis roots to abiotic stress. Science, 2008. 320(5878): p. 942-5 [PMID:18436742]